Recombinant Mycoplasma capricolum subsp. capricolum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
atpF; MCAP_0080; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Target Names
atpF
Target Protein Sequence
MLSVGFNIAINATTQGVPKIIESLFPNLPNFIAHLLATIVLVIVLAKLVYKPYKQMIEKQ RQKITEVLSDAIEKQTQANIKIKQANSLLEEAKTESVSIINTARVDAEIQKNKIIDNANL QAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILSKEIDKNTNKKLIEEFIKDL D
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural composition of ATP synthase subunit b (atpF) in Mycoplasma species?

ATP synthase subunit b (atpF) in Mycoplasma species is a membrane-bound protein component of the F0 sector of ATP synthase. Based on related Mycoplasma species data, it typically consists of approximately 180-190 amino acids, with the protein folding into a structural component that anchors the ATP synthase complex in the membrane. The protein contains both hydrophobic regions that span the membrane and hydrophilic regions that interact with other ATP synthase subunits. In Mycoplasma mobile, for example, the full-length protein consists of 184 amino acids with specific regions serving as transmembrane domains and others involved in protein-protein interactions essential for complex assembly .

How does ATP synthase function differ in Mycoplasma compared to mitochondrial ATP synthase?

ATP synthase in Mycoplasma differs significantly from mitochondrial ATP synthase due to the prokaryotic nature of Mycoplasma. While both utilize the same fundamental rotary mechanism, Mycoplasma ATP synthase operates in the plasma membrane rather than an organellar membrane. The basic mechanism remains similar—both use proton gradients to drive mechanical rotation that enables ATP synthesis, with protons passing through ATP synthase causing rotation of a rotor consisting of 10-14 subunits .

Unlike mitochondrial ATP synthase, which is part of a larger respiratory chain system, Mycoplasma ATP synthases have evolved to function in a minimalist organism with a reduced genome. Some Mycoplasma species' ATP synthases may have adapted to function under different conditions or utilize different ion gradients compared to their mitochondrial counterparts. For instance, some bacterial ATP synthases can utilize sodium ion gradients instead of proton gradients under certain conditions, similar to what has been observed in E. callanderi .

What is the evolutionary significance of atpF in minimal genomes like Mycoplasma?

The retention of ATP synthase genes, including atpF, in minimal genomes like Mycoplasma highlights their essential role in cellular bioenergetics. Evolutionary analysis suggests that the rotary mechanism of ATP synthase, despite its complexity, provides significant kinetic advantages over simpler alternating-access mechanisms, particularly under low-energy conditions . This kinetic advantage likely explains why even organisms with highly reduced genomes maintain this complex machinery.

The presence of atpF in Mycoplasma species represents an evolutionary conservation of a critical bioenergetic component, even as these organisms have eliminated many seemingly essential genes during reductive evolution. This conservation suggests that the specific function of atpF cannot be readily replaced by alternative mechanisms, making it an interesting subject for studying core cellular functions that have persisted through evolutionary pressure toward genomic minimization . The study of atpF in minimal genomes offers insights into the fundamental bioenergetic requirements of life and the limits of genomic reduction.

What experimental approaches are most effective for assessing the function of recombinant Mycoplasma capricolum atpF in vitro?

Effective functional assessment of recombinant Mycoplasma capricolum atpF requires a multi-faceted approach combining reconstitution experiments with detailed biochemical analyses. The most robust methodology employs proteoliposome systems where purified recombinant atpF is incorporated into artificial membranes alongside other ATP synthase components.

A comprehensive experimental design should include:

  • Liposome reconstitution: Incorporate purified recombinant atpF with other ATP synthase subunits into liposomes with defined lipid composition to mimic native membrane environments.

  • ATP synthesis assays: Measure ATP synthesis using luciferase-based continuous monitoring systems while manipulating ion gradients. As demonstrated in studies with other ATP synthases, apply potassium diffusion potentials using valinomycin to generate membrane potential (Δψ) while controlling sodium or proton gradients .

  • Control experiments: Include appropriate controls with ionophores (e.g., TCS or ETH2120) to abolish gradients, and perform reactions without ADP to confirm ATP synthesis specificity .

The following table outlines key parameters for a systematic functional analysis:

ParameterVariation RangeMeasurement TechniqueExpected Outcome
Membrane potential (Δψ)10-500 mVK+ diffusion with valinomycinLinear relationship with synthesis rate
Ion gradient (ΔpNa or ΔpH)1-200 mMVariable buffer concentrationsLogarithmic relationship with rate
Temperature25-42°CControlled reaction chamberOptimal activity around physiological temperature
pH6.0-8.5Buffered solutionsBell-shaped activity curve

Analysis of these parameters will allow determination of the thermodynamic and kinetic properties of the atpF-containing ATP synthase complex, revealing its specific contributions to the enzyme's function .

How do mutations in the atpF gene affect ATP synthase assembly and function in Mycoplasma species?

Mutations in the atpF gene can significantly disrupt ATP synthase assembly and function through several mechanisms, based on research in related systems. The subunit b (atpF) serves as a critical structural component that connects the membrane-embedded F0 portion with the catalytic F1 portion of ATP synthase.

Key consequences of atpF mutations include:

  • Assembly defects: Mutations in conserved regions of atpF can prevent proper interaction with other subunits, particularly subunits alpha and gamma, disrupting the assembly of the complete ATP synthase complex. Research on ATP synthase formation has shown that specific molecular chaperones, such as Hsp70, are involved in the assembly process, and mutations in atpF can interfere with these chaperone-assisted assembly pathways .

  • Stability issues: Even when assembly occurs, certain mutations can reduce the stability of the complex, leading to decreased enzyme persistence and function over time.

  • Altered ion flow: Mutations near the membrane-spanning regions can modify the proton channel characteristics, affecting the efficiency of proton translocation and consequently reducing ATP synthesis rates.

  • Conformational coupling defects: Some mutations may allow assembly but disrupt the mechanical coupling between proton movement and the rotary mechanism, reducing the conversion efficiency of the proton-motive force into ATP synthesis.

The most severe phenotypes typically result from mutations in highly conserved residues or domains that are directly involved in subunit interactions or mechanically critical regions. Complementation studies, where wild-type atpF is reintroduced into mutant strains, can confirm the specific role of atpF in observed phenotypes .

What are the contradictions in current literature regarding ion specificity of Mycoplasma ATP synthases?

The scientific literature presents several contradictory findings regarding the ion specificity of Mycoplasma ATP synthases, reflecting broader debates about ATP synthase function across species. These contradictions center on whether these enzymes exclusively use protons (H+) or can also utilize sodium ions (Na+) as the coupling ion for ATP synthesis.

Key contradictions include:

The table below summarizes key contradictory findings:

AspectContradictory FindingsPossible Explanations
Ion specificityH+-specific vs. Na+-compatibleSpecies-specific adaptations; Experimental conditions
Component equivalenceΔψ and ΔpH fully equivalent vs. Δψ requirementActivation thresholds; Different assay systems
Efficiency measurementsVarying H+/ATP ratios (3-4 vs. >4)Methodological differences; Species variation

Resolving these contradictions requires standardized methodologies and direct comparative studies between different Mycoplasma species under identical experimental conditions .

What are the optimal conditions for expressing recombinant Mycoplasma capricolum atpF protein in E. coli?

Optimizing expression of recombinant Mycoplasma capricolum atpF protein in E. coli requires careful consideration of multiple parameters to maximize yield while maintaining protein functionality. Based on successful expression strategies for other Mycoplasma proteins, including the closely related M. mobile atpF, the following approach is recommended:

  • Expression system selection: BL21(DE3) or Rosetta(DE3) E. coli strains are preferred due to their reduced protease activity and enhanced expression capabilities. For membrane proteins like atpF, C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression may yield better results .

  • Vector design: Use pET-based vectors with an N-terminal His-tag for ease of purification. The inclusion of a cleavable tag is advisable to facilitate removal after purification if required for functional studies .

  • Codon optimization: Mycoplasma species use a different codon preference than E. coli, so codon optimization of the atpF gene sequence is essential for efficient expression. Alternatively, use E. coli strains supplemented with rare tRNAs (like Rosetta).

  • Expression conditions: Optimal expression typically occurs at lower temperatures (16-20°C) with extended induction times (16-24 hours) to promote proper folding of membrane proteins. IPTG concentration should be optimized, typically starting with 0.1-0.5 mM.

  • Media formulation: Enriched media such as Terrific Broth supplemented with glucose (0.5%) can enhance protein yield.

The following table summarizes optimal expression parameters:

ParameterRecommended ConditionRationale
E. coli strainC41(DE3) or Rosetta(DE3)Enhanced membrane protein expression
VectorpET with N-terminal His-tagEfficient expression and purification
Induction temperature18°CPromotes proper folding
IPTG concentration0.2 mMBalances expression and toxicity
Induction time18 hoursAllows accumulation of correctly folded protein
MediaTerrific Broth + 0.5% glucoseProvides resources for high-yield expression

Post-expression, solubilization with mild detergents (DDM or LMNG) is recommended for membrane protein extraction prior to purification using immobilized metal affinity chromatography .

What techniques are most effective for measuring ATP synthesis activity of reconstituted Mycoplasma ATP synthase?

Measuring ATP synthesis activity of reconstituted Mycoplasma ATP synthase requires sensitive, real-time assays that can accurately quantify ATP production under varying conditions. Based on established methodologies for ATP synthase research, the following techniques are most effective:

  • Luciferase-based continuous monitoring: This is the gold standard for real-time ATP synthesis measurements, allowing continuous tracking of ATP production. The approach involves mixing proteoliposomes containing reconstituted ATP synthase with luciferase reagents in a microplate format, followed by establishing baseline luminescence before initiating the reaction with ADP and an ionophore (typically valinomycin) to generate the necessary driving force .

  • Ion gradient establishment methods:

    • For Δψ-driven synthesis: Create potassium diffusion potentials by incorporating low K+ concentrations in liposomes (e.g., 0.5 mM) and high external K+ (10-500 mM), with valinomycin addition to induce potential.

    • For ΔpH-driven synthesis: Establish pH gradients using different internal and external buffer pH values.

    • For ΔpNa-driven synthesis: Create sodium gradients with high internal Na+ (e.g., 200 mM) and variable external Na+ (1-15 mM) .

  • Critical control experiments:

    • Protonophore controls (e.g., TCS) to collapse Δψ

    • Na+ ionophore controls (e.g., ETH2120) to collapse ΔpNa

    • ADP omission controls to confirm ATP synthesis specificity

    • Enzyme inhibitor controls (oligomycin or DCCD) to confirm ATP synthase dependence

  • Data acquisition and analysis:

    • Record luminescence continuously at 37°C for optimal activity measurement

    • Calculate initial rates from the linear portion of the curve (typically first 2 minutes)

    • Express activity in nmol ATP·min-1·mg protein-1

    • Perform all measurements in triplicate from independent preparations

This methodology allows systematic investigation of ATP synthesis under varying driving forces, enabling detailed characterization of the thermodynamic and kinetic properties of Mycoplasma ATP synthase .

How can researchers effectively investigate the interaction between atpF and other ATP synthase subunits?

Investigating interactions between atpF and other ATP synthase subunits requires a multi-technique approach that combines structural, biochemical, and biophysical methods. The following comprehensive strategy enables effective characterization of these protein-protein interactions:

  • Co-immunoprecipitation (Co-IP) and pull-down assays:

    • Use tagged recombinant atpF (e.g., His-tagged as described for M. mobile atpF ) to pull down interacting subunits from Mycoplasma lysates

    • Perform reciprocal experiments with tagged versions of suspected interacting partners

    • Quantify interaction strength under varying conditions (pH, salt, nucleotides)

  • Crosslinking and mass spectrometry:

    • Apply chemical crosslinkers with different spacer lengths to capture transient interactions

    • Analyze crosslinked complexes using tandem mass spectrometry (MS/MS)

    • Map interaction interfaces by identifying crosslinked residues

    • This approach provides spatial constraints for molecular modeling

  • Surface plasmon resonance (SPR) and microscale thermophoresis (MST):

    • Quantify binding kinetics and affinity between purified atpF and other subunits

    • Determine how mutations affect binding parameters

    • Assess the influence of different conditions on interaction stability

  • Cryogenic electron microscopy (cryo-EM):

    • Analyze the structure of reconstituted ATP synthase complexes

    • Compare wild-type structures with those containing mutated atpF

    • Identify subtle conformational changes that affect complex stability or function

  • Molecular dynamics simulations:

    • Model interactions based on experimental constraints

    • Predict effects of mutations or conditions on complex formation

    • Generate hypotheses for experimental validation

The involvement of chaperones, particularly Hsp70, in ATP synthase assembly provides another avenue for investigation . Researchers should consider how these assembly factors influence the interactions between atpF and other subunits, potentially using techniques such as chaperone depletion or reconstitution with purified chaperones to assess their specific roles.

Integration of these complementary approaches provides a comprehensive understanding of how atpF contributes to ATP synthase structure and function through its interactions with other subunits of this complex molecular machine .

How do biophysical properties of atpF contribute to the rotary mechanism advantage in ATP synthase?

The biophysical properties of atpF (subunit b) play a critical role in the functional advantage of ATP synthase's rotary mechanism over simpler alternating-access mechanisms. Recent comparative biophysical analyses highlight several key contributions:

  • Structural rigidity and elasticity balance: The atpF subunit functions as a critical stator element in ATP synthase, requiring specific mechanical properties. It must maintain sufficient rigidity to prevent futile rotation of the F1 sector while possessing enough elasticity to accommodate the conformational changes during catalysis. This precise mechanical balance contributes to the rotary mechanism's kinetic advantage, particularly under low-energy conditions .

  • Energy transmission efficiency: The biophysical properties of atpF facilitate efficient transmission of energy from the proton-motive force to the catalytic sites. Computational and experimental analyses suggest that the rotary mechanism, supported by properly functioning stator elements like atpF, achieves higher ATP synthesis rates than alternative mechanisms under equivalent driving forces .

  • Contribution to kinetic optimization: When optimized subject to thermodynamic constraints, the rotary mechanism incorporating atpF consistently outperforms alternating-access models across a wide range of conditions. Mathematical modeling indicates that the rotary mechanism's ability to maintain high synthesis rates even under low-energy conditions reflects evolutionary selection pressure for kinetic advantage .

The specific amino acid composition and secondary structure elements of atpF contribute to these properties. For Mycoplasma mobile atpF, the amino acid sequence (MLELGIFSSNTQNIGQSISERFAGIFPSWPIMLATLVSFTILLVVLTKLIYKPVKKMMKNRRDFIQNNIDESTKQVEKSNELLEKSNIEILDAKIKANTIIKDAQILAEEIKNNSIKDAKDKSKQLLEETKIYIRQQKVLFAKESKKEIVEIAGEMTKKILSESDVKLEDSKFLENLLKNDITK) contains regions that create the necessary structural and dynamic properties .

These biophysical insights explain why evolution has conserved this complex rotary mechanism across diverse life forms, including minimalist organisms like Mycoplasma .

What are the implications of studying Mycoplasma ATP synthase for understanding minimal cellular energy requirements?

Studying Mycoplasma ATP synthase provides unique insights into minimal cellular energy requirements due to Mycoplasma's position as one of nature's simplest self-replicating organisms. This research has several significant implications:

  • Defining bioenergetic minimalism: Mycoplasma species have undergone extreme genome reduction during evolution, retaining only essential genes. The preservation of the ATP synthase complex, including atpF, indicates that this machinery represents an irreducible minimum for cellular energy conversion. Analysis of its structure and function reveals the fundamental requirements for biological ATP synthesis .

  • Evolutionary constraints on energy systems: The retention of a complex rotary ATP synthase in organisms that have eliminated many seemingly essential genes suggests strong evolutionary selection against simpler energy-generating mechanisms. Biophysical comparisons demonstrate that the rotary mechanism provides superior kinetic performance, particularly under limiting conditions, explaining why evolution has preserved this complexity despite pressure for genomic minimization .

  • Implications for synthetic biology and minimal cell design: Understanding the specific contributions of atpF and other ATP synthase components in Mycoplasma informs efforts to design synthetic minimal cells. Research indicates that attempts to further simplify the ATP synthesis machinery beyond what occurs in Mycoplasma may compromise energetic efficiency. This has practical implications for designing artificial cells or engineering organisms with minimal genomes .

The following table summarizes key insights gained from Mycoplasma ATP synthase research:

AspectFindingImplication
Structural complexityRotary mechanism preserved despite genome minimizationComplex ATP synthesis machinery likely represents a bioenergetic minimum
Kinetic advantageSuperior performance over simpler mechanisms, especially at low energyExplains evolutionary conservation of complex system
Ion utilizationPossible adaptation to utilize different ion gradientsReveals flexibility in minimal energy systems
Thermodynamic efficiencyOperation close to theoretical limitsDemonstrates evolutionary optimization of essential energy conversion

These findings collectively suggest that the ATP synthase represents a core module of life's minimal energy requirements, with implications for understanding both natural minimal organisms and designing synthetic ones .

How can structural information about atpF inform the development of antimicrobials targeting Mycoplasma species?

The structural information about ATP synthase subunit b (atpF) presents a valuable opportunity for developing targeted antimicrobials against Mycoplasma species, which are significant pathogens in both human and veterinary medicine. This approach offers several advantages:

  • Exploiting structural uniqueness: Detailed structural analysis of Mycoplasma atpF reveals distinct features compared to host ATP synthases. The amino acid sequence of Mycoplasma atpF (as exemplified by M. mobile atpF's sequence) contains regions that differ significantly from mammalian counterparts . These unique structural elements can serve as selective targets for antimicrobial compounds that disrupt Mycoplasma energy production without affecting host cells.

  • Targeting critical interfaces: Structural studies of atpF's interaction with other ATP synthase subunits identify critical protein-protein interfaces essential for complex assembly and function. Small molecules designed to interfere with these specific interactions could prevent proper ATP synthase assembly, thereby inhibiting bacterial energy production. This approach is particularly promising because:

    • ATP synthase function is essential for Mycoplasma survival

    • The interfaces between subunits often involve highly conserved residues less prone to resistance mutations

    • Structure-based design can maximize selectivity for bacterial over mammalian interfaces

  • Structure-based compound screening methodology:

    • Perform in silico docking of compound libraries against binding pockets identified in atpF crystal or cryo-EM structures

    • Validate binding using techniques such as surface plasmon resonance or thermal shift assays

    • Assess functional impact using ATP synthesis assays in reconstituted liposome systems

    • Evaluate antimicrobial activity in whole-cell assays against various Mycoplasma species

    • Measure selectivity by comparing effects on bacterial versus mammalian ATP synthase

  • Potential for addressing antimicrobial resistance: The essential nature of ATP synthase and its conservation across Mycoplasma species make it a high-value target for addressing the growing problem of antimicrobial resistance. Compounds targeting unique features of atpF could potentially overcome existing resistance mechanisms by exploiting a novel target pathway.

The development of atpF-targeted antimicrobials represents a promising approach for creating narrow-spectrum antibiotics with reduced side effects and decreased likelihood of promoting resistance in non-target organisms .

What are the most critical knowledge gaps in our understanding of Mycoplasma atpF function?

Despite significant advances in ATP synthase research, several critical knowledge gaps remain in our understanding of Mycoplasma atpF function. These gaps represent important research opportunities:

  • Species-specific adaptations: While we have structural information about atpF from some Mycoplasma species (e.g., M. mobile ), we lack comprehensive comparative analyses across the Mycoplasma genus. It remains unclear how variations in atpF sequence and structure contribute to species-specific adaptations in diverse ecological niches and host environments.

  • Ion specificity mechanisms: The molecular basis for ion specificity in Mycoplasma ATP synthases remains incompletely understood. Whether specific residues in atpF contribute to determining proton versus sodium ion utilization, and how these preferences might be modulated by environmental conditions, represents a significant knowledge gap .

  • Assembly pathway details: While chaperones like Hsp70 have been implicated in ATP synthase assembly , the precise sequence of events and specific interactions involving atpF during the assembly process in Mycoplasma remain poorly characterized. Understanding these assembly pathways could identify new intervention points for antimicrobial development.

  • Regulatory mechanisms: How Mycoplasma regulates ATP synthase activity in response to changing environmental conditions is not well understood. The potential roles of atpF modifications (such as phosphorylation) or interactions with regulatory proteins in modulating ATP synthase function require further investigation.

  • Evolution of complexity: While biophysical analyses suggest why the complex rotary mechanism has been evolutionarily conserved , the specific evolutionary trajectory of atpF in Mycoplasma species during genome minimization remains to be fully elucidated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.