Recombinant Mycoplasma capricolum subsp. capricolum ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mycoplasma capricolum subsp. capricolum ATP Synthase Subunit c (atpE)

Recombinant Mycoplasma capricolum subsp. capricolum ATP synthase subunit c (atpE) is a bioengineered protein derived from the ATP synthase complex of this mycoplasma species. ATP synthase is a critical enzyme in cellular energy production, coupling proton translocation to ATP synthesis. The subunit c protein, encoded by the atpE gene, forms part of the F₀ subcomplex, which facilitates proton transport across cellular membranes .

Expression Systems

SystemKey FeaturesApplication
E. coliN-terminal His-tag for purification; scalable productionStructural studies
Cell-Free SystemsHost-independent expression; rapid protein synthesis (e.g., in vitro folding)Functional assays

E. coli remains the primary host due to its compatibility with His-tag purification and cost-effectiveness . Cell-free systems offer advantages for studying subunit c’s folding dynamics or interactions with other ATP synthase subunits .

Comparative Analysis with Other ATP Synthase Subunits

SubunitRole in ATP SynthaseSpecies-Specific Notes
Subunit c (atpE)Forms proton channel (F₀); drives c-ring rotationCritical for proton translocation in M. capricolum
Subunit β (atpF)Catalytic subunit (F₁); binds ATP/ADPExpressed alongside atpE in E. coli
Subunit ε (atpC)Regulatory subunit; modulates ATP synthase activityNot encoded in minimal mycoplasma genomes

Challenges and Future Directions

  • Functional Redundancy: Unlike mammalian subunit c isoforms (P1, P2, P3), M. capricolum lacks isoform diversity, limiting studies on subunit-specific roles .

  • Diagnostic Utility: While M. capricolum subsp. capripneumoniae is diagnosed via atpE-targeted PCR , similar applications for capricolum remain unexplored.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format preferences, kindly indicate your requirement when placing the order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. We kindly recommend consulting your local distributors for specific delivery timelines.
Please note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please communicate with us in advance as an additional fee will be applicable.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. To ensure optimal preservation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
atpE; MCAP_0079; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Target Names
atpE
Target Protein Sequence
MLHTAFISNILANYLGAMSVILPNILTVTGDIKYIGAGLASVGILGTGVGQGLIGQGACL AIGRNPEMASKVTSTMIVSAGISESGAIYSLVIAILLIFVV
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase is an enzyme responsible for generating ATP from ADP in the presence of a proton or sodium gradient. This enzyme comprises two structural domains: F(1), which houses the extramembraneous catalytic core, and F(0), which contains the membrane proton channel. These domains are interconnected via a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The c-ring, composed of 10-14 homomeric subunits, constitutes the central stalk rotor element, interacting with the F(1) delta and epsilon subunits.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit c (atpE) in Mycoplasma capricolum and what is its fundamental role?

ATP synthase subunit c (atpE) in Mycoplasma capricolum is a critical component of the F-type ATP synthase complex, specifically located in the F0 sector. The protein functions as part of a cylindrical oligomer (typically c10) that plays a direct role in the proton pumping process of ATP synthesis . This 101-amino acid protein (including mature protein and targeting sequence) is also known as ATP synthase F(0) sector subunit c, F-type ATPase subunit c, or Lipid-binding protein . The mature atpE protein directly cooperates with subunit a (Atp6-equivalent) to facilitate proton movement across the membrane, which drives the synthesis of ATP through the creation of a proton gradient .

How is the structure of Mycoplasma capricolum atpE characterized and how does it differ from other bacterial species?

The Mycoplasma capricolum atpE gene (MCAP_0079) encodes a protein with the amino acid sequence: mLHTAFISNILANYLGAMSVILPNILTVTGDIKYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLVIAILLIFVV . Unlike the mammalian ATP synthase subunit c that has three isoforms differing in their targeting peptides, bacterial atpE typically has only one form . The Mycoplasma capricolum atpE represents a minimal functional unit, which makes it valuable for studying the fundamental mechanisms of ATP synthesis in simplified biological systems. This simplicity has made Mycoplasma an appealing model organism for synthetic biology applications and genome editing studies.

What are the optimal storage and handling conditions for recombinant Mycoplasma capricolum atpE protein?

For optimal preservation of recombinant Mycoplasma capricolum atpE protein activity, storage at -20°C in Tris-based buffer with 50% glycerol is recommended for long-term maintenance . For extended storage periods, conservation at -80°C may provide better stability. Repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity . For short-term work, maintaining working aliquots at 4°C for up to one week is advisable. When planning experiments, it's best to prepare small working aliquots to minimize freeze-thaw cycles, and the protein should be kept on ice during experimental procedures to maintain structural integrity.

What methods are most effective for expressing and purifying functional Mycoplasma capricolum atpE?

Expression and purification of functional Mycoplasma capricolum atpE requires careful consideration of expression systems and purification strategies. While the search results don't provide a specific protocol for this particular protein, effective approaches based on related proteins include:

  • Expression System Selection:

    • E. coli expression systems are commonly used for Mycoplasma proteins

    • Codon optimization may be necessary due to the different codon usage between Mycoplasma and E. coli

  • Purification Strategy:

    • Affinity chromatography using histidine tags or other fusion tags

    • Size exclusion chromatography to ensure oligomeric integrity

    • Ion exchange chromatography for further purification

  • Functional Assessment:

    • ATP hydrolysis assays to verify enzymatic activity

    • Reconstitution experiments in liposomes to assess proton pumping capability

When designing expression constructs, it's important to consider the hydrophobic nature of this membrane protein, which may require detergent solubilization during purification steps.

What genome editing techniques are most effective for modifying the atpE gene in Mycoplasma capricolum?

While the search results don't directly address genome editing in Mycoplasma capricolum, insights can be drawn from related Mycoplasma species. In Mycoplasma pneumoniae, oligo recombineering has been successfully employed for genome editing with varying efficiencies depending on modification size . For atpE gene editing in Mycoplasma capricolum, several approaches could be effective:

  • Oligo Recombineering:

    • For small modifications (1 bp changes), efficiency can reach approximately 10^-2 to 10^-1

    • Larger modifications (50-1800 bp) show reduced efficiency (10^-4 to 10^-3)

  • CRISPR-Cas9 Enhancement:

    • Combining oligo recombineering with CRISPR-Cas9 selection can significantly improve editing efficiency

    • This approach is particularly valuable for larger modifications where initial editing rates might be lower than Cas9 evader rates

  • Optimization Parameters:

    • Post-transformation incubation time significantly impacts editing efficiency; longer intervals (24-48h) allow for replication fork passage across the targeted locus

    • Multiple electroporation pulses (optimally 6) can increase transformation efficiency

For successful atpE editing, consideration should be given to Mycoplasma's slow doubling time (approximately 8 hours) when designing experimental timelines.

How can researchers accurately determine editing rates when modifying the atpE gene in Mycoplasma?

Determining accurate editing rates for atpE gene modifications requires systematic approaches. Based on methodologies used for other Mycoplasma genes, the following protocol can be adapted:

  • Post-Transformation Processing:

    • Harvest cells at appropriate time points post-transformation (optimal timing: 24-48 hours)

    • Prepare serial dilutions (10^-1 to 10^-8) of transformed cells

  • Selection and Quantification:

    • Plate dilutions on selective and non-selective media

    • Calculate editing rate as: (number of resistant colonies)/(total number of colonies)

  • Statistical Analysis:

    • Perform paired t-test analysis across biological replicates

    • Consider establishing a detection limit (e.g., 500 CFU) for statistical purposes

  • Verification Methods:

    • PCR amplification and sequencing of the modified region

    • Functional assays to confirm phenotypic changes

    • For atpE specifically, ATP synthesis assays would be appropriate

This methodical approach ensures reliable determination of editing efficiency and facilitates comparison between different editing strategies.

How does Mycoplasma capricolum atpE compare with ATP synthase subunit c in other Mycoplasma species?

Comparing Mycoplasma capricolum atpE with homologs in other Mycoplasma species reveals important evolutionary and functional insights. While the search results don't provide direct comparisons, we can infer:

  • Structural Conservation:

    • The core functional regions of atpE are likely highly conserved across Mycoplasma species due to their essential role in energy metabolism

    • Species-specific variations may occur in non-catalytic regions

  • Diagnostic Applications:

    • The genetic differences between Mycoplasma species' atpE genes make them valuable targets for species differentiation

    • High-resolution melting (HRM) curve analysis has been effectively used to differentiate between Mycoplasma species, suggesting sufficient genetic variability exists

  • Functional Equivalence:

    • Despite sequence variations, the fundamental role in proton transport and ATP synthesis is preserved across species

    • These proteins likely maintain similar structural arrangements within the ATP synthase complex

Researchers focusing on comparative studies should consider these variations when designing experiments or developing diagnostic tools for Mycoplasma species identification.

What are the key differences between bacterial and mammalian ATP synthase subunit c, and how do these differences impact research approaches?

Bacterial (including Mycoplasma capricolum) and mammalian ATP synthase subunit c exhibit several important differences that influence research strategies:

  • Isoform Diversity:

    • Mammals have three isoforms of F1F0-ATP synthase subunit c (P1, P2, P3) that differ in their mitochondrial targeting peptides while sharing identical mature peptides

    • Bacterial systems like Mycoplasma typically have a single atpE form

  • Functional Redundancy:

    • In mammals, the three isoforms are not functionally redundant despite identical mature peptides

    • Silencing individual isoforms in mammalian cells results in ATP synthesis defects

    • Bacterial systems rely on a single form for functionality

  • Targeting Peptide Function:

    • Mammalian targeting peptides play roles beyond protein import, including respiratory chain maintenance

    • Bacterial atpE lacks these targeting sequences and associated secondary functions

  • Expression Patterns:

    • Mammalian isoforms show tissue-specific expression patterns (P1 levels generally lower than P2/P3)

    • Bacterial expression is more uniform throughout the organism

These differences necessitate distinct experimental approaches when studying bacterial versus mammalian ATP synthase systems, particularly regarding genetic manipulation strategies and functional analysis methods.

How can researchers utilize recombinant Mycoplasma capricolum atpE for structural studies and drug development?

Recombinant Mycoplasma capricolum atpE offers valuable opportunities for structural studies and drug development through several approaches:

  • Structural Analysis:

    • X-ray crystallography of purified atpE to determine precise molecular structure

    • Cryo-electron microscopy to visualize the protein within the larger ATP synthase complex

    • NMR studies to analyze dynamics and interactions with other subunits

    • In silico modeling to predict structural changes during proton translocation

  • Drug Target Identification:

    • Screening for small molecules that specifically bind to Mycoplasma atpE

    • Structure-based design of inhibitors that disrupt ATP synthesis

    • Comparative analysis with host ATP synthase to identify Mycoplasma-specific binding sites

  • Validation Assays:

    • Development of high-throughput screening assays using recombinant atpE

    • Establishing proton translocation assays in reconstituted systems

    • Confirming specificity by comparing effects on host versus pathogen ATP synthase

The structural simplicity of Mycoplasma capricolum atpE makes it an excellent model for understanding the fundamental mechanisms of ATP synthesis, which can inform broader studies across bacterial species.

What are the current methodological challenges in studying ATP synthase function in Mycoplasma and how might they be overcome?

Researchers face several methodological challenges when studying ATP synthase function in Mycoplasma species, including:

  • Genetic Manipulation Limitations:

    • Challenge: Low transformation efficiency and editing rates in Mycoplasma species

    • Solution: Optimize transformation protocols with multiple electroporation pulses and extended recovery times (24-48h)

    • Solution: Combine oligo recombineering with CRISPR-Cas9 selection to enhance editing efficiency

  • Functional Assessment:

    • Challenge: Difficulty in measuring ATP synthesis in the native membrane environment

    • Solution: Develop improved in vitro reconstitution systems that maintain the native lipid environment

    • Solution: Implement cytochrome c oxidation-based ATP synthesis measurement methods adapted from mammalian studies

  • Protein Expression:

    • Challenge: Membrane protein expression and purification issues

    • Solution: Utilize specialized expression hosts optimized for membrane proteins

    • Solution: Employ detergent screening to identify optimal solubilization conditions

  • Species Differentiation:

    • Challenge: Distinguishing between closely related Mycoplasma species

    • Solution: Implement high-resolution melting (HRM) curve analysis for rapid and accurate identification

    • Solution: Develop species-specific primers based on unique gene sequences

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, and advanced biophysical techniques.

How can atpE be used as a target for the detection and differentiation of Mycoplasma capricolum from other Mycoplasma species?

The atpE gene offers potential for specific detection and differentiation of Mycoplasma capricolum from other Mycoplasma species through several molecular approaches:

  • High-Resolution Melting (HRM) Analysis:

    • HRM curve analysis using specific primers targeting the atpE gene region can provide rapid identification

    • Similar approaches for other Mycoplasma species show high specificity with intra- and inter-batch coefficients of variation < 1%

    • This method offers advantages in terms of speed and sensitivity compared to traditional culturing methods

  • Species-Specific PCR:

    • Development of primers targeting unique regions of the atpE gene can enable species-specific detection

    • This approach could be adapted into quantitative PCR formats for pathogen load assessment

  • Comparative Performance:

    • When developed appropriately, molecular detection methods targeting genes like atpE can achieve detection limits of approximately 55-58 copies/μL

    • These molecular methods typically show higher sensitivity than traditional culturing approaches (coincidence rates between HRM and culturing of approximately 87%)

Targeting the atpE gene for diagnostic purposes would be particularly valuable for differentiating between closely related Mycoplasma species that cause similar clinical presentations in affected animals.

What are the most sensitive and specific methods for detecting Mycoplasma capricolum in research and diagnostic settings?

For detecting Mycoplasma capricolum in both research and diagnostic settings, several methods offer varying advantages in terms of sensitivity, specificity, and practicality:

  • Molecular Detection Methods:

    • High-Resolution Melting (HRM) analysis shows superior sensitivity compared to conventional PCR and culturing methods

    • Quantitative PCR (qPCR) using fluorescence offers good sensitivity with a coincidence rate of 94.8% when compared with HRM

    • These molecular approaches can detect low pathogen loads in various sample types including nasal swabs and lung tissue samples

  • Traditional Culturing:

    • While less sensitive than molecular methods, culturing provides viable organisms for further characterization

    • Culturing remains important for antimicrobial susceptibility testing and strain archiving

    • Coincidence rates between HRM and culturing have been reported at approximately 87%

  • Method Selection Considerations:

    • Sample type (tissue, swab, fluid)

    • Required turnaround time

    • Need for quantitative results

    • Available laboratory infrastructure

In research settings where rapid results are needed, HRM analysis offers the best combination of speed, sensitivity, and specificity, while diagnostic laboratories might employ a combination of molecular and culturing approaches for comprehensive analysis.

How can researchers effectively measure and analyze ATP synthase activity in recombinant Mycoplasma capricolum atpE systems?

Measuring ATP synthase activity in recombinant Mycoplasma capricolum atpE systems requires specialized methodologies that address the unique characteristics of this protein:

  • In Vitro Reconstitution Systems:

    • Reconstitute purified recombinant atpE into liposomes with appropriate lipid composition

    • Incorporate complete F0 sector components for functional studies

    • Establish proton gradient using pH shifts or light-driven proton pumps

  • Activity Measurement Approaches:

    • Luciferase-based ATP quantification assays to measure ATP synthesis rates

    • Cytochrome c oxidation-coupled ATP synthesis measurement, adapted from methods used in mammalian studies

    • Oxygen consumption measurement using Clark-type electrodes to assess respiratory activity

  • Inhibitor Studies:

    • Oligomycin sensitivity assays to confirm F0 sector functionality

    • N,N,N′,N′-Tetramethyl-p-phenylenediamine (TMPD) utilization for cytochrome pathway analysis

    • Potassium cyanide (KCN) inhibition studies to assess mitochondrial respiration dependency

These methodologies allow researchers to quantitatively assess the functionality of recombinant atpE and its role within the larger ATP synthase complex.

What experimental approaches best demonstrate the role of atpE in proton translocation and ATP synthesis?

To effectively demonstrate the critical role of atpE in proton translocation and ATP synthesis, researchers can employ several complementary experimental approaches:

  • Site-Directed Mutagenesis Studies:

    • Introduce mutations at key residues involved in proton binding and translocation

    • Assess the impact on ATP synthesis rates and proton pumping efficiency

    • Create chimeric proteins with sections from different species to identify critical functional domains

  • Biophysical Characterization:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis

    • Patch-clamp electrophysiology to directly measure proton currents

    • Hydrogen/deuterium exchange mass spectrometry to identify dynamic regions involved in proton pathway

  • Functional Reconstitution:

    • Reconstitute purified atpE with other ATP synthase components in liposomes

    • Establish proton gradients and measure resulting ATP synthesis

    • Compare wild-type and mutant atpE performance under identical conditions

  • Computational Approaches:

    • Molecular dynamics simulations to model proton movement through the c-ring

    • Quantum mechanical calculations to understand energetics of proton transfer

    • In silico docking studies to identify potential inhibitor binding sites

These experimental approaches provide complementary data that together build a comprehensive understanding of atpE's fundamental role in coupling proton movement to ATP synthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.