Recombinant Mycoplasma capricolum subsp. capricolum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; MCAP_0868; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Target Names
yidC
Target Protein Sequence
MSYLNASKNKKAPKTKKEIFKVVIKWLKVFGFLFILVSMLWGCVQMYQAQYSVNQIVDMT GKSVYTPGVSFEIILSSLGEQGSKVHHFVYDKGSFFEYGYNAITSWKETFKLTQSPFYGF FVYPTAWILAGMIKLFSGTLNPLLDKSSQLTYGISSIFAIFLTTLLIKGITLSFGWKSQI NQEKMQDIQLKVADIQAKYKDKKDMQSKQKQQLEIQALYKKENMSQFSALAGSFAPLPFL FAIYAIVRSTRALKIASVGPIALIEGPWQQITAGNYIYIIILAIYLPLQAVSMLLPTLLQ MKKQKSITLTEAQKKSRKKQLIMQVVMMFVFIIIIVSVATGVCIYWIFSSILQIIQTYAF YLYNEKKRKAGNQERQRRLRQMERMNLK
Uniprot No.

Target Background

Function
This protein plays a crucial role in the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Furthermore, it aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of YidC in bacterial membrane protein biogenesis?

YidC belongs to the evolutionarily conserved YidC/Oxa1/Alb3 protein family that facilitates membrane protein biogenesis across all domains of life. In bacteria, YidC serves three principal functions: (1) as a cooperative insertase working alongside the Sec translocon to insert and fold membrane proteins, (2) as an independent insertase for "YidC-only" substrates that bypass the Sec machinery, and (3) as a foldase that promotes the proper assembly of membrane protein complexes and the correct folding of periplasmic domains of membrane proteins . The protein contains a characteristic U-shaped hydrophilic groove that is closed on the periplasmic side but exposed to the cytoplasmic side of the membrane bilayer, which is critical for its insertase function .

How does the structural arrangement of YidC contribute to its insertase function?

YidC exhibits a specific structural architecture consisting of multiple transmembrane domains (TMDs) with both the cytoplasmic and periplasmic regions playing distinct roles in substrate recognition and insertion. The protein features a U-shaped hydrophilic groove formed by transmembrane helices TM1-TM5 that provides a protected environment for membrane protein insertion . Additionally, YidC contains a cytoplasmic α-helical hairpin that participates in the initial binding of substrate polypeptides. During the insertion process, essential TMDs 2 and 3 of YidC undergo conformational changes, tilting to accommodate the substrate, while the amphipathic helix EH1 relocates into the hydrophobic core of the membrane . This dynamic structural rearrangement facilitates the progressive movement of substrate transmembrane segments from the hydrophilic environment into the lipid bilayer.

What are the most effective methods for studying YidC-substrate interactions?

Multiple complementary approaches have proven effective for investigating YidC-substrate interactions:

  • Single-molecule force spectroscopy: This technique allows for the measurement of binding forces between YidC and its substrates at the individual molecule level, revealing the mechanical stability of these interactions .

  • Fluorescence spectroscopy: Used to monitor conformational changes and binding kinetics in real-time. Studies have employed this approach to demonstrate that YidC binds to the polypeptide of membrane proteins such as Pf3 with high conformational variability within 2 milliseconds, followed by strengthened binding and conformational changes occurring within 52 milliseconds .

  • Molecular dynamics simulations: These computational approaches provide insights into the structural dynamics of YidC during the insertion process, highlighting water movement within the hydrophilic groove and conformational changes in both YidC and its substrates .

  • Ribosome nascent chain complex (RNC) binding assays: By creating RNCs with varying nascent chain lengths, researchers can determine how YidC recognizes and binds to emerging transmembrane domains at different stages of translation .

Each method offers unique advantages and, when used in combination, provides a comprehensive understanding of the mechanistic aspects of YidC-mediated insertion.

How can researchers effectively reconstitute YidC into membrane mimetic systems for functional studies?

For functional studies of YidC, reconstitution into appropriate membrane mimetic systems is crucial. The most commonly used approaches include:

  • Nanodisc reconstitution: YidC can be incorporated into nanodiscs (YidC-ND), which are disc-shaped phospholipid bilayers surrounded by membrane scaffold proteins. This system allows for the study of YidC in a native-like environment while maintaining water solubility. For optimal results, researchers should use a YidC:lipid:scaffold protein ratio that ensures predominantly single YidC insertion per nanodisc .

  • Proteoliposome preparation: YidC can be reconstituted into liposomes composed of defined lipid mixtures. This approach is particularly valuable for assessing how membrane composition affects YidC function. Studies have demonstrated that YidC can efficiently catalyze membrane insertion in both fluid and gel phase membranes, highlighting its versatility .

  • Detergent solubilization and purification: Prior to reconstitution, YidC is typically solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM). After purification (often using affinity tags like His-tags), the protein can be incorporated into the membrane mimetic of choice by detergent removal methods such as dialysis or adsorption onto hydrophobic beads .

When designing reconstitution experiments, researchers should consider lipid composition, protein-to-lipid ratios, and buffer conditions to ensure optimal YidC activity and stability.

How does the hydrophilic groove of YidC facilitate membrane protein insertion?

The hydrophilic groove of YidC plays a critical role in membrane protein insertion through a sophisticated mechanism involving water dynamics and conformational changes:

  • Water slide mechanism: The U-shaped hydrophilic groove within helices TM1-TM5 functions as a water-filled chamber that provides a favorable environment for nascent transmembrane domains. During the initial phase of insertion (as observed in pose 1 simulations), the groove contains a high number of water molecules. As insertion progresses (pose 2), the water content decreases to nearly zero .

  • Hydrophilic-to-hydrophobic transition: The presence of water in the groove creates a "water slide" that facilitates the initial entry of the substrate protein. As the substrate advances through the insertion process, the cytoplasmic groove becomes more compact, expelling water molecules. This results in a hydrophobic shift that promotes the substrate's integration into the membrane .

  • Salt bridge formation: During insertion, specific ionic interactions form between charged residues on YidC and the substrate. For example, studies with the Pf3 coat protein have shown that the negatively charged D7 residue of Pf3 interacts with the positively charged R72 of YidC, forming a stable salt bridge that is crucial for stabilizing Pf3 in YidC's transmembrane groove .

Insertion StageWater Content in YidC GrooveYidC ConformationKey Molecular Interactions
Initial (Pose 1)HighOpen groove structureInitial substrate binding at cytoplasmic loops
IntermediateDecreasingProgressive narrowingFormation of salt bridges (e.g., D7-R72)
Final (Pose 2)Near zeroCompact grooveSubstrate-lipid interactions; D18-R72 salt bridge

This sequential process demonstrates how YidC provides a protected pathway for membrane proteins to transition from the hydrophilic cytoplasm to the hydrophobic membrane environment.

What are the kinetic parameters of YidC-mediated membrane insertion?

The kinetics of YidC-mediated membrane insertion follow a multi-step process with distinct temporal phases:

  • Initial substrate binding (0-2 ms): Within the first 2 milliseconds, the cytoplasmic α-helical hairpin of YidC binds to the polypeptide of membrane proteins such as Pf3. This initial binding is characterized by high conformational variability but demonstrates significant kinetic stability .

  • Binding strengthening and transfer (2-52 ms): Over the next 50 milliseconds, YidC strengthens its interaction with the substrate and utilizes both the cytoplasmic α-helical hairpin domain and the hydrophilic groove to facilitate the transfer of the substrate to the membrane-inserted state .

  • Complete insertion and folding: In the final membrane-inserted state, the substrate (e.g., Pf3) exhibits low conformational variability, typical of properly folded transmembrane α-helical proteins .

The efficiency of YidC-mediated insertion is influenced by multiple factors, including nascent chain length and exposure. Studies using ribosome nascent chain complexes (RNCs) with varying lengths of the Pf3 coat protein (Foc) have demonstrated that binding efficiency correlates directly with nascent chain exposure:

RNC ConstructNascent Chain ExposureYidC-ND Binding Efficiency
Foc-FL or Foc-Δ5Full TM domain~90%
Foc-Δ10Partial TM domain62%
Foc-Δ20Fragment of TM domain30%
Non-translating 70SNo nascent chain<10%

These data indicate that while YidC can recognize nascent chains at early translation stages, maximum binding efficiency occurs only when the transmembrane domain is fully exposed outside the ribosomal tunnel .

How does YidC interact with ribosomes during co-translational membrane insertion?

YidC engages with ribosomes during co-translational membrane insertion through a sophisticated interplay that depends on nascent chain exposure and specific binding interfaces:

  • Nascent chain recognition: YidC can recognize and bind to ribosome-exposed nascent chains at early stages of translation, but binding efficiency reaches its maximum only when the nascent transmembrane domain (TMD) is fully exposed outside the ribosomal tunnel . This suggests a progressive engagement model where initial weak interactions are strengthened as more of the substrate becomes available.

  • Binding interfaces: The interaction involves both ribosomal components and the emerging nascent chain. While direct interactions with the ribosome are relatively weak (<10% binding efficiency for non-translating 70S ribosomes), the presence of an exposed nascent chain dramatically enhances binding (up to ~90% for fully exposed TMDs) .

  • Conformational changes: Upon binding to ribosome-nascent chain complexes (RNCs), YidC undergoes specific conformational changes that prepare it for the insertion process. Cryo-electron microscopy studies have revealed that the essential transmembrane domains 2 and 3 of YidC tilt, while the amphipathic helix EH1 relocates into the hydrophobic core of the membrane .

This dynamic interaction ensures that YidC is optimally positioned to receive and insert the nascent membrane protein as it emerges from the ribosome, facilitating efficient co-translational membrane integration.

What protein-protein interactions influence YidC function in membrane protein biogenesis?

YidC participates in multiple protein-protein interactions that modulate its function in membrane protein biogenesis:

  • YibN interaction: Recent research has identified YibN as a bona fide physical and functional interactor of YidC with implications for membrane protein insertion and lipid organization. Affinity pulldown experiments using recombinant His-tagged YidC followed by mass spectrometry analysis have confirmed this interaction . This association suggests that YidC may function within a larger network of proteins that collectively regulate membrane protein biogenesis.

  • Sec translocon cooperation: YidC can work in conjunction with the Sec translocon (SecYEG complex) to facilitate the insertion of certain membrane proteins. In this context, YidC may assist in the lateral release of transmembrane segments from the Sec channel into the lipid bilayer and/or aid in the proper folding of the inserted proteins .

  • Penicillin binding protein (PBP) folding: YidC assists in the correct folding of penicillin binding proteins, which contain one transmembrane segment and a large periplasmic domain involved in peptidoglycan synthesis. Studies have shown that in the absence of YidC, critical PBPs are not correctly folded, even though their total amount in the membrane remains unaffected . This finding extends YidC's role as a foldase beyond membrane protein complexes to include the periplasmic domains of membrane proteins.

Understanding these interactions provides insights into how YidC functions within the broader context of cellular membrane protein biogenesis machinery and offers potential targets for modulating this essential process.

How can YidC be utilized as a model system for studying membrane protein insertases across different domains of life?

YidC represents an excellent model system for studying membrane protein insertion mechanisms due to its evolutionary conservation and functional versatility:

  • Evolutionary conservation: YidC belongs to the YidC/Oxa1/Alb3 protein family, which is present in all domains of life (YidC in bacteria, Oxa1 in mitochondria, and Alb3 in chloroplasts) . This conservation suggests that mechanistic insights gained from studying bacterial YidC may be applicable to its homologs in eukaryotic organelles.

  • Methodological advantages: The bacterial YidC system offers practical advantages for mechanistic studies, including ease of genetic manipulation, protein expression, and purification. Researchers can leverage various techniques including:

    • Single-molecule approaches to study conformational dynamics

    • Reconstitution into defined membrane mimetics

    • Cryo-EM structures to visualize insertion intermediates

    • Molecular dynamics simulations to model insertion processes

  • Comparative analysis: By comparing the structures and functions of YidC homologs from different species and organelles, researchers can identify conserved mechanistic principles and species-specific adaptations. This comparative approach can provide insights into how insertase functions have evolved to accommodate different membrane environments and substrate repertoires.

The methodological frameworks developed for studying YidC can serve as templates for investigating other membrane protein biogenesis factors, contributing to a comprehensive understanding of membrane protein folding and assembly across biological systems.

What are the promising research directions for developing YidC-based applications in synthetic biology?

The fundamental role of YidC in membrane protein biogenesis opens several promising research directions for synthetic biology applications:

  • Enhanced membrane protein expression systems: Engineered YidC variants with optimized substrate binding and insertion properties could facilitate the efficient production of difficult-to-express membrane proteins for structural studies and biotechnological applications. By modifying the hydrophilic groove or cytoplasmic domains, researchers might create YidC variants with broader substrate specificity or enhanced insertion efficiency.

  • Minimal cell systems: As researchers work toward creating minimal cell systems, understanding and optimizing YidC function is crucial since membrane protein insertion is an essential cellular process. Recombinant Mycoplasma capricolum YidC, coming from an organism with a naturally minimal genome, could provide insights into the minimal requirements for membrane protein insertion machinery .

  • Membrane protein folding quality control: The dual insertase/foldase function of YidC suggests potential applications in creating cellular systems with enhanced quality control for membrane protein folding. Such systems could be valuable for expressing correctly folded membrane proteins for structural studies or therapeutic applications.

  • Designer membrane protein assembly pathways: Based on the mechanistic understanding of YidC-mediated insertion, synthetic biologists could design specialized membrane protein assembly pathways for novel membrane proteins with non-natural functions, such as artificial channels, sensors, or energy-transducing complexes.

Future research should focus on characterizing the substrate specificity determinants of YidC, engineering YidC variants with modified properties, and integrating YidC function with other components of synthetic cellular systems.

What strategies can address common challenges in the expression and purification of recombinant YidC?

Researchers working with recombinant YidC often encounter several challenges during expression and purification. The following methodological approaches can help overcome these issues:

  • Optimizing expression conditions:

    • Use specialized expression strains (e.g., C41(DE3), C43(DE3)) designed for membrane protein expression

    • Employ low-temperature induction (16-20°C) to slow protein synthesis and improve folding

    • Consider using weaker promoters or lower inducer concentrations to prevent toxic accumulation

    • Test different fusion tags (His-tag, MBP, GST) at either N- or C-terminus to improve expression and solubility

  • Effective membrane extraction:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) that maintain YidC structure and function

    • Optimize detergent concentration and extraction time to maximize yield while preserving activity

    • Consider sequential extraction with different detergents to improve purity

  • Purification strategies:

    • Implement multi-step purification combining affinity chromatography with size exclusion and/or ion exchange

    • Include stabilizing agents (glycerol, specific lipids) in all buffers to maintain protein integrity

    • Consider on-column detergent exchange to transition to more favorable detergents for downstream applications

  • Activity preservation:

    • Verify functional activity using insertion assays with model substrates like Pf3 coat protein

    • Incorporate specific lipids (PE, PG, cardiolipin) that may be required for optimal YidC activity

    • Minimize freeze-thaw cycles and store purified protein at concentrations >1 mg/ml to reduce aggregation

When working specifically with Mycoplasma capricolum YidC, researchers should account for potential species-specific requirements for expression and stability that may differ from the more commonly studied E. coli YidC.

How can researchers effectively assess the functional activity of purified YidC?

  • In vitro insertion assays:

    • Proteoliposome-based assays: Reconstitute purified YidC into liposomes and assess its ability to insert model substrates such as Pf3 coat protein. Success can be measured by protease protection assays, where properly inserted proteins are protected from externally added proteases .

    • Real-time fluorescence-based assays: Label substrate proteins with environmentally sensitive fluorophores that change emission properties upon membrane insertion, allowing for kinetic monitoring of the insertion process .

  • Ribosome binding assays:

    • Co-sedimentation assays: Mix purified YidC (in detergent or reconstituted into nanodiscs) with ribosome nascent chain complexes (RNCs) and analyze complex formation by ultracentrifugation and subsequent SDS-PAGE analysis .

    • Fluorescence-based binding assays: Use fluorescently labeled YidC to quantify binding to RNCs with different nascent chain lengths and compositions, providing information on binding specificity and affinity .

  • Conformational analyses:

    • Limited proteolysis: Compare digestion patterns of purified YidC in the presence and absence of substrate proteins to assess conformational changes upon substrate binding.

    • Circular dichroism spectroscopy: Monitor secondary structure content to ensure proper folding of purified YidC.

    • Thermal shift assays: Evaluate protein stability under different buffer conditions to optimize storage and experimental conditions.

Assay TypeKey ParametersExpected Results for Functional YidC
Proteoliposome insertionSubstrate type, lipid composition, pH, temperature50-90% insertion efficiency for model substrates
RNC bindingNascent chain length, RNC concentration~90% binding for fully exposed TMDs, 30-60% for partially exposed TMDs
Conformational analysisBuffer conditions, detergent typePredominantly α-helical content, distinct conformational changes upon substrate binding

When interpreting these assays, researchers should compare their results with published data on well-characterized YidC proteins and include appropriate positive and negative controls to validate assay performance.

How do structural and functional differences between YidC homologs from various bacterial species impact experimental design?

YidC homologs across bacterial species display important structural and functional variations that must be considered when designing experiments:

  • Structural variations:

    • Domain architecture: While the core transmembrane domain structure is relatively conserved, the number of transmembrane segments can vary. For example, Escherichia coli YidC has 6 transmembrane domains, whereas some Gram-positive bacteria have 5 transmembrane domains.

    • Periplasmic domain size: The P1 domain size varies significantly between species, affecting substrate interactions and potentially experimental approaches.

    • C-terminal extensions: Some YidC homologs possess extended C-terminal regions that may interact with additional factors, requiring consideration in construct design.

  • Substrate specificity differences:

    • Different YidC homologs may exhibit varying affinities and insertion efficiencies for the same substrates. For example, when using model substrates like Pf3 coat protein, researchers should verify that the chosen YidC homolog can efficiently process this substrate.

    • Species-specific substrate preferences may necessitate the use of endogenous substrates when studying non-model YidC proteins.

  • Experimental implications:

    • Expression systems: Codon optimization based on the source organism is often necessary for efficient heterologous expression.

    • Buffer conditions: The optimal detergent type, pH, and salt concentration may vary significantly between YidC homologs from different species.

    • Reconstitution parameters: Lipid composition should ideally reflect the native membrane environment of the specific YidC being studied.

When working specifically with Mycoplasma capricolum YidC, researchers should note that Mycoplasma species have evolved in nutrient-rich environments with reduced genomes, potentially resulting in YidC variants with specialized properties adapted to their unique cellular context.

What insights can be gained by comparing YidC from Mycoplasma capricolum with other bacterial YidC homologs?

Comparative analysis of Mycoplasma capricolum YidC with other bacterial homologs provides valuable insights into insertase evolution and adaptation:

  • Evolutionary adaptation to minimal genomes:

    • Mycoplasma species have undergone reductive evolution, retaining only essential genes. The presence and conservation of YidC in these minimal genomes underscores its fundamental importance in cellular physiology.

    • Comparing the functional capabilities of Mycoplasma YidC with those from bacteria with larger genomes can reveal the core, indispensable functions of this insertase family.

  • Structural simplification and specialization:

    • Analysis of Mycoplasma capricolum YidC may reveal structural simplifications that represent the minimal functional architecture required for membrane protein insertion.

    • Any Mycoplasma-specific structural features might indicate adaptations to the unique membrane composition of these organisms, which lack a cell wall and have distinctive lipid compositions.

  • Substrate range adaptation:

    • Mycoplasma genomes encode fewer membrane proteins compared to most bacteria, potentially resulting in a more specialized YidC with a narrower substrate range.

    • Comparative substrate specificity studies between Mycoplasma YidC and other bacterial homologs can illuminate how insertases adapt to different proteome requirements.

  • Methodological advantages:

    • The potential structural simplicity of Mycoplasma YidC may offer advantages for structural studies, potentially providing clearer insights into core insertase mechanisms without confounding domains.

    • As a naturally minimal system, Mycoplasma capricolum YidC could serve as an excellent model for understanding the fundamental principles of membrane protein insertion that have been conserved throughout bacterial evolution.

This comparative approach not only enriches our understanding of YidC biology but also provides practical insights for designing experiments with different YidC homologs and interpreting results within their evolutionary context.

How can proteomics approaches be used to comprehensively identify the YidC-dependent membrane proteome?

Systems-level proteomics provides powerful tools for mapping the complete set of YidC-dependent membrane proteins:

  • Comparative membrane proteomics:

    • SILAC-based approaches: Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with membrane fractionation and mass spectrometry can quantitatively compare membrane protein abundance in wild-type versus YidC-depleted cells. This approach has successfully identified YidC-dependent proteins in various bacteria .

    • TMT labeling: Tandem Mass Tag (TMT) labeling offers multiplexing capabilities, allowing researchers to compare multiple conditions (e.g., YidC depletion, overexpression, and mutant variants) in a single experiment.

  • Interaction proteomics:

    • Affinity pulldown with quantitative MS: His-tagged YidC can be used to capture interaction partners, which are then identified by LC-MS/MS. This approach has successfully identified proteins like YibN as functional interactors of YidC .

    • Proximity labeling: Techniques such as BioID or APEX2 fused to YidC can label proximal proteins in vivo, providing insights into the dynamic interactome of YidC during membrane protein insertion.

  • Substrate identification strategies:

    • Ribosome profiling: Changes in ribosome density on membrane protein-encoding mRNAs upon YidC depletion can indicate translation pausing due to inefficient membrane insertion.

    • Pulse-chase experiments: Comparing the kinetics of membrane protein maturation in the presence and absence of YidC can identify proteins whose biogenesis is YidC-dependent.

Proteomics ApproachKey AdvantagesKey LimitationsNotable Findings
SILAC membrane proteomicsQuantitative, high dynamic rangeRequires auxotrophic strainsIdentified YidC dependence of PBPs and respiratory complexes
Affinity pulldown MSIdentifies direct and indirect interactorsMay capture non-physiological interactionsDiscovered YibN-YidC functional interaction
Proximity labelingCaptures transient interactions in native environmentPotential background labelingCan map spatial organization of insertion machinery

These approaches collectively provide a comprehensive view of the YidC-dependent membrane proteome and insertion machinery interactome, offering insights into the cellular roles of YidC beyond individual substrate studies.

What computational approaches can predict YidC-dependent membrane proteins and their insertion mechanisms?

Computational methods offer valuable tools for predicting YidC substrates and modeling insertion mechanisms:

  • Substrate prediction algorithms:

    • Sequence-based predictors: Machine learning approaches trained on known YidC substrates can identify sequence patterns or physicochemical properties that distinguish YidC-dependent from Sec-dependent or spontaneously inserting membrane proteins.

    • Topology analysis: Algorithms that analyze transmembrane domain topology, hydrophobicity profiles, and charge distribution can predict whether a membrane protein is likely to require YidC for insertion.

    • Evolutionary conservation patterns: Comparative genomics approaches that correlate the presence of YidC homologs with specific membrane protein families across species can identify likely YidC substrates.

  • Structural modeling and simulations:

    • Molecular dynamics simulations: As demonstrated with the Pf3 coat protein, all-atom MD simulations can model YidC-substrate interactions and conformational changes during the insertion process .

    • Water dynamics modeling: Specialized simulations focusing on water movements within the YidC hydrophilic groove can provide insights into the "water slide" mechanism of insertion .

    • Coarse-grained simulations: These allow modeling of longer timescale processes such as complete membrane protein insertion and folding events that are inaccessible to all-atom simulations.

  • Systems-level modeling:

    • Kinetic models: Mathematical models describing the rates of different steps in YidC-mediated insertion (binding, conformational change, membrane integration) can predict insertion efficiency for different substrates.

    • Genome-scale models: Integration of YidC-dependent insertion into whole-cell models can predict the systems-level impact of YidC perturbations on cellular physiology.

The combination of experimental proteomics data with these computational approaches enables researchers to build comprehensive models of YidC-dependent membrane protein insertion, facilitating both basic mechanistic understanding and practical applications in biotechnology and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.