Recombinant Mycoplasma capricolum subsp. capricolum Uncharacterized protein MCAP_0005 (MCAP_0005)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. For long-term storage, we recommend adding 5–50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MCAP_0005; Uncharacterized protein MCAP_0005; ORF L5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Target Names
MCAP_0005
Target Protein Sequence
MISDFNNQEITLEDLEQNNVKLKEGKAKVQFLMRFSLVFSNIFTHIFLFLLIIVSGLFFG LRYTYYNYKIDLITNVYKIKPSIPKLKEIYKEVLEVVDEVKRETDKNSEDSLINKIDEIR GIVKEVTNIAKEFDEKSKEVKPKVEKVIQEGKQVTSNLDKITKEIQALQVNGNGLASRVR RSLTGDINTITNLANNIDFDFNSVKESIEKITGLAQQISKEGKSITKNVEEIKNEVEYFT GKSKEPLKDIDKIKQIYDKKIPIFEKNNKKLQEIWNKLMGIYNEFTVKETKKDYYNYVIY ILLFLIIDSLILLVITYMSMISKTIKKLLLFYIFGLLSFNPIVWASIIISLFSRPIKNRK NKFY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant MCAP_0005?

E. coli is the primary expression system used for recombinant MCAP_0005 production . When selecting an expression system, researchers should consider:

  • Vector selection: Both high-copy (pMB1-derived, 500-700 copies/cell) and low-copy (p15A, ~10 copies/cell) vectors have been evaluated for recombinant protein expression .

  • Promoter systems: The choice between P T7, Plac, and other promoter systems significantly impacts expression levels .

  • Host strain: E. coli BL21 is commonly used for recombinant protein expression, with specific genetic backgrounds (wild-type vs. metabolic mutants like ΔackA) affecting yields .

For MCAP_0005 specifically, E. coli expression with N-terminal His-tagging has produced functional protein for research applications . Generally, expression optimization requires evaluating multiple combinations of these factors through systematic testing.

How should MCAP_0005 protein be stored and handled to maintain stability?

For optimal stability of recombinant MCAP_0005:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, aliquot the protein to prevent repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

These handling procedures apply specifically to the His-tagged recombinant MCAP_0005 protein and should be adjusted based on experimental requirements and specific preparation methods.

What strategies can improve expression yields of recombinant MCAP_0005?

Several advanced strategies can enhance MCAP_0005 expression yields:

  • Codon optimization: Since Mycoplasma has different codon usage compared to E. coli, codon optimization can significantly improve translation efficiency. This is particularly important for regions with rare codons that may cause ribosomal pausing .

  • Expression vector optimization: Research indicates that the combination of replication origin and promoter significantly impacts recombinant protein yields. A comparative study showed:

Vector SystemRelative Expression (%)Protein Concentration (mg/L)
p15A-trc-YFP (glycerol)100~18-20
pMB1'-trc-YFP (glycerol)~80~14-16
p15A-T7-YFP (glycerol)~75~13-15
pMB1'-T7-YFP (glycerol)~60~10-12

While this data is from a YFP expression study, similar principles apply to MCAP_0005 expression .

  • Metabolic burden management: The metabolic load associated with recombinant protein expression can decrease yields. Using glycerol instead of glucose as carbon source and selecting appropriate host strains (e.g., E. coli ΔackA mutant) can mitigate these effects .

  • Induction optimization: For IPTG-inducible systems, concentrations of 0.1-1.0 mM have been tested, with 0.1 mM often providing optimal balance between expression and metabolic burden .

What purification approaches are most effective for His-tagged MCAP_0005?

For His-tagged MCAP_0005 protein, a multi-step purification strategy is recommended:

  • Initial IMAC purification: Use nickel-affinity chromatography with carefully optimized imidazole concentrations:

    • Binding buffer: 20-50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-20 mM imidazole

    • Wash buffer: Same with 20-50 mM imidazole

    • Elution buffer: Same with 250-500 mM imidazole

  • Second purification step: Size exclusion chromatography (SEC) to remove aggregates and achieve >90% purity as verified by SDS-PAGE .

  • Quality control: Verify full-length protein acquisition through SDS-PAGE analysis, as translation initiation problems may result in truncated products. To distinguish full-length proteins from truncated versions, vectors with fusion tags on both ends can be employed with increased imidazole concentration during elution .

For membrane proteins like MCAP_0005 that may have hydrophobic domains, addition of mild detergents (0.01-0.05% DDM or CHAPS) in purification buffers can improve solubility and prevent aggregation.

What are the challenges in structural and functional characterization of MCAP_0005?

As an uncharacterized protein, MCAP_0005 presents several research challenges:

  • Structural characterization barriers:

    • Potential membrane association makes crystallization difficult

    • Hydrophobic regions (evident in the amino acid sequence: "FLFLLIIVSGLFFG" and "ILLFLIIDSLILLVITYMSMISK") may cause aggregation in aqueous solutions

    • Limited homology to characterized proteins complicates structure prediction

  • Functional analysis approaches:

    • Protein interaction studies using pull-down assays to identify binding partners

    • Localization studies in Mycoplasma cells using fluorescently-tagged versions

    • Comparative genomics with related Mycoplasma species

    • Gene knockout/knockdown to assess phenotypic changes

  • Expression system limitations:

    • E. coli expression may not reproduce native post-translational modifications

    • Transmembrane protein challenges require specialized extraction techniques to maintain conformation and activity

    • Possible protein toxicity requiring regulated expression systems

Researchers should consider eukaryotic expression systems like insect cells if E. coli expression yields unstable protein, particularly if post-translational modifications are suspected to be important for function.

How can researchers troubleshoot low expression or insolubility issues with MCAP_0005?

When encountering expression or solubility challenges with MCAP_0005:

  • For low expression levels:

    • Evaluate different E. coli strains (BL21(DE3), Rosetta, Origami)

    • Test alternative promoter systems beyond T7 or trc

    • Optimize growth temperature (reduced temperature often improves folding)

    • Consider co-expression with molecular chaperones (GroEL/ES, DnaK/J)

  • For insolubility issues:

    • Modify induction parameters (lower IPTG concentration, induce at lower OD)

    • Express fusion constructs with solubility-enhancing tags (MBP, SUMO, TrxA)

    • Test alternative lysis buffers with varying salt concentrations and pH

    • Screen detergents for membrane protein extraction (CHAPS, DDM, Triton X-100)

  • For purification challenges:

    • Implement on-column refolding protocols for inclusion body preparation

    • Use dual tagging strategies (His-tag plus additional affinity tag)

    • Optimize buffer compositions based on computational prediction of protein properties

Statistical analysis of expression conditions using factorial experimental design can systematically identify optimal parameters rather than trial-and-error approaches alone.

What experimental approaches can determine MCAP_0005 subcellular localization?

To determine MCAP_0005 subcellular localization:

  • Immunofluorescence microscopy:

    • Generate antibodies against purified MCAP_0005 or use anti-His antibodies

    • Fix Mycoplasma capricolum cells with paraformaldehyde

    • Perform immunostaining with fluorophore-conjugated secondary antibodies

    • Co-stain with markers for subcellular compartments

  • Fluorescent protein fusion:

    • Create N- and C-terminal GFP/YFP fusion constructs

    • Express in Mycoplasma under native promoter if possible

    • Analyze live-cell localization using confocal microscopy

  • Subcellular fractionation:

    • Separate Mycoplasma membrane and cytosolic fractions

    • Analyze MCAP_0005 distribution by Western blot

    • Use fraction-specific markers to validate separation quality

  • Protease accessibility assays:

    • Treat intact cells with membrane-impermeable proteases

    • Analyze protection patterns to determine membrane topology

    • Compare with computational topology predictions from the sequence

These approaches should be used complementarily, as each has limitations. For example, overexpression or tag addition may disrupt natural localization.

What bioinformatic tools are most useful for predicting MCAP_0005 function?

Multiple bioinformatic approaches can provide functional insights:

  • Sequence analysis tools:

    • BLAST for homology identification (https://blast.ncbi.nlm.nih.gov)

    • TMHMM or TOPCONS for transmembrane domain prediction

    • SignalP for signal peptide detection

    • InterProScan for functional domain identification

  • Structural prediction:

    • AlphaFold2 for ab initio 3D structure prediction

    • I-TASSER for template-based modeling

    • SWISS-MODEL for homology modeling

    • MolProbity for structure validation

  • Genomic context analysis:

    • Examine gene neighborhood in Mycoplasma genomes

    • Identify co-occurring genes across species

    • Analyze operonic structures if present

  • Systems biology approaches:

    • Protein-protein interaction prediction using STRING database

    • Metabolic pathway analysis for contextual placement

    • Gene expression correlation analysis

The amino acid sequence features "FLFLLIIVSGLFFG" and "ILLFLIIDSLILLVITYMSMISK" strongly suggest transmembrane segments, indicating MCAP_0005 may function as a membrane protein, potentially in transport or signaling .

How can researchers design knockout/knockdown experiments to study MCAP_0005 function?

For functional studies through genetic manipulation:

  • Gene knockout approaches in Mycoplasma:

    • Homologous recombination with antibiotic resistance cassettes

    • Targeted CRISPR-Cas9 system adapted for Mycoplasma

    • Transposon mutagenesis with screening for MCAP_0005 disruption

  • Knockdown strategies:

    • Antisense RNA expression targeting MCAP_0005 mRNA

    • CRISPRi using catalytically inactive Cas9 to block transcription

    • Destabilizing domain fusion for controlled protein degradation

  • Phenotypic analysis:

    • Growth curve analysis under various conditions

    • Microscopic examination for morphological changes

    • Transcriptomic/proteomic profiling of knockout strains

    • Stress response assessment (pH, temperature, oxidative stress)

  • Complementation testing:

    • Reintroduce wild-type or mutant MCAP_0005 variants

    • Use inducible promoters for titrated expression

    • Employ heterologous expression in related Mycoplasma species

These genetic approaches require careful control experiments and multiple independent mutants to verify phenotypes, especially since MCAP_0005 may be essential for viability under certain conditions.

How might MCAP_0005 be utilized in studying Mycoplasma-host interactions?

MCAP_0005 could provide insights into Mycoplasma-host interactions through:

  • Interaction studies with host proteins:

    • Pull-down assays using immobilized MCAP_0005 with host cell lysates

    • Yeast two-hybrid screening against human/animal protein libraries

    • Surface plasmon resonance (SPR) with candidate host proteins

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Immunological studies:

    • Assess MCAP_0005 immunogenicity in host systems

    • Determine if anti-MCAP_0005 antibodies are present in infected hosts

    • Evaluate pro-inflammatory responses to purified MCAP_0005

    • Test MCAP_0005 as a potential vaccine candidate

  • Host cell response analysis:

    • Transcriptomic/proteomic profiling of host cells exposed to MCAP_0005

    • MCAP_0005-induced changes in host cell signaling pathways

    • Effects on host cell cytoskeleton or membrane integrity

  • In vivo infection models:

    • Compare wild-type vs. MCAP_0005-deficient Mycoplasma strains

    • Track tissue distribution and persistence in infection models

    • Assess virulence differences in MCAP_0005 mutants

These approaches could reveal whether MCAP_0005 functions as a virulence factor, adhesin, or plays another role in host-pathogen interactions.

What are the best approaches for studying potential post-translational modifications of MCAP_0005?

To investigate post-translational modifications (PTMs) of MCAP_0005:

  • Mass spectrometry-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Enrichment techniques for specific PTMs (phosphopeptide enrichment, etc.)

    • Top-down proteomics for intact protein analysis

    • Comparison of native vs. recombinant protein modifications

  • Site-directed mutagenesis:

    • Mutate predicted modification sites (Ser, Thr, Tyr for phosphorylation)

    • Express mutant variants and assess functional consequences

    • Create non-modifiable or phosphomimetic variants

  • PTM-specific detection methods:

    • Western blotting with modification-specific antibodies

    • Phos-tag SDS-PAGE for phosphorylation detection

    • Pro-Q Diamond staining for phosphoprotein visualization

    • Periodic acid-Schiff staining for glycosylation

  • Enzymatic modification/demodification:

    • Treatment with phosphatases, glycosidases, or other PTM-removing enzymes

    • In vitro kinase assays to identify potential enzymes involved

    • Co-expression with modification enzymes in recombinant systems

Although Mycoplasma has a minimal genome, its proteins can still undergo phosphorylation and other basic modifications that might regulate MCAP_0005 function.

How can structural biology techniques be applied to understand MCAP_0005?

For structural characterization of MCAP_0005:

  • X-ray crystallography approaches:

    • Crystallization screening with membrane protein-specific detergents

    • Lipidic cubic phase crystallization for membrane proteins

    • Use of crystallization chaperones or antibody fragments

    • Surface entropy reduction mutagenesis to promote crystal contacts

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure

    • Cryo-electron tomography if expressed in native membranes

    • 2D crystallization in lipid bilayers

  • NMR spectroscopy:

    • Solution NMR for soluble domains

    • Solid-state NMR for membrane-embedded regions

    • Selective isotope labeling for specific residue analysis

  • Hybrid approaches:

    • Small-angle X-ray scattering (SAXS) for solution conformation

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry for distance constraints

    • Integration with computational predictions (AlphaFold2)

Given the potential membrane association of MCAP_0005, detergent screening is crucial. A systematic approach testing different detergent classes (maltosides, glucosides, phosphocholines, etc.) at various concentrations would be necessary to identify conditions that maintain native conformation while promoting structural analysis.

What are the most promising research directions for understanding MCAP_0005 function?

The most promising avenues for uncovering MCAP_0005 function include:

  • Comprehensive structural characterization:

    • Obtaining high-resolution structures through X-ray crystallography or cryo-EM

    • Membrane topology mapping through accessibility studies

    • Identifying functional domains through systematic mutagenesis

  • Systems biology integration:

    • Transcriptomic and proteomic profiling of MCAP_0005 knockout strains

    • Metabolomic analysis to identify affected pathways

    • Network analysis placing MCAP_0005 in Mycoplasma cellular processes

  • Evolutionary analysis:

    • Comparative genomics across Mycoplasma species and related genera

    • Identification of selective pressure signatures in the gene sequence

    • Reconstruction of evolutionary history and potential functional shifts

  • Mycoplasma-host interaction studies:

    • Role in adhesion, invasion, or immune evasion

    • Contribution to Mycoplasma pathogenicity

    • Potential as diagnostic marker or therapeutic target

These complementary approaches would provide a comprehensive understanding of this currently uncharacterized protein, potentially revealing new insights into minimal genome organisms and host-pathogen interactions.

How might technological advances improve our ability to study proteins like MCAP_0005?

Emerging technologies that could enhance MCAP_0005 research include:

  • Advanced structural methods:

    • Micro-electron diffraction (MicroED) for small crystals

    • Time-resolved structural studies to capture conformational changes

    • Integrative structural biology combining multiple data sources

  • Single-cell and single-molecule techniques:

    • Single-molecule fluorescence resonance energy transfer (smFRET)

    • Live-cell single-particle tracking of labeled MCAP_0005

    • Single-cell proteomics to detect low-abundance interactions

  • Enhanced computational approaches:

    • AI-driven function prediction beyond sequence homology

    • Molecular dynamics simulations in membrane environments

    • Quantum mechanics/molecular mechanics for potential enzymatic activities

  • Synthetic biology platforms:

    • Minimal cell systems incorporating MCAP_0005

    • Cell-free expression systems for difficult proteins

    • CRISPR-based high-throughput functional screening

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.