Recombinant Mycoplasma gallisepticum ATP synthase protein I (atpI)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
atpI; MYCGA2990; MGA_1163; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2))
Target Names
atpI
Target Protein Sequence
MIVDKKIIKYNLIIFNVFSIVGLIILLGLTFTKIIGFQWVYSSLLTVVFSNISLVIGLIL
PNLLYTSATKLNTQQVKSARFGFFILGIITLSSRLFWYAVPIVIIGFVNQWQFQGAVFNV
FPAILWPLSMIAVHVVVNYLLLNKEIKERNKLKELNNNVATGDSLHEAF
Uniprot No.
Target Background
Function
This protein potentially plays a role in guiding the assembly of the membrane sector of the ATPase enzyme complex.
Database Links
KEGG: mga:MGA_1163
Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
