Recombinant Mycoplasma gallisepticum Lipoprotein signal peptidase (lspA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery time
may vary depending on the purchasing method and location. Please consult your local distributors
for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please specify it, and we will prioritize its development.
Synonyms
lspA; MYCGA2100; MGA_0997; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2))
Target Names
lspA
Target Protein Sequence
MYTFKRYLTKTKDTLIRQFKAANAKKLIKIKYPILAVMGFFVLLIVFVLRDYFLKLGIGH
STSTGFITINVITNSGVGFSLFNQNPAVPYLLQSLLTIIFLITFIFSKNKALIVLLPLIT
FGGLANVIDRSVPVTLSNGTVETNSVLDYFQFFRSSAIFNFADICIVTGFALIFLTFVVD
IFLDLKKKNKKTVSTTNKQLHGWKSIPLEERSKWNDWADHKCVFCNQQMMINSNEVICSN
EECAYIDLINIAKPISVEKQENCLICNSEMIKKVDDKQASFLACSRFNEKCYYTKSCKQI
ENNA
Uniprot No.
Target Background
Function
This protein is specifically designed to catalyze the removal of signal peptides from prolipoproteins.
Database Links
KEGG: mga:MGA_0997
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
