Recombinant Mycoplasma gallisepticum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role and Biological Significance

1.1 Lipoprotein Biosynthesis Pathway
Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins, forming mature lipoproteins . This modification is essential for anchoring lipoproteins to bacterial membranes and is a prerequisite for subsequent processing by signal peptidase II (Lsp) and N-acyl transferase (Lnt) .

Role in M. gallisepticum

  • M. gallisepticum lipoproteins are predominantly diacylated due to the absence of Lnt, though triacylation has been hypothesized .

  • Lipoproteins like GapA and VlhA are virulence factors involved in adhesion and immune evasion . Lgt’s role in their maturation suggests its importance in pathogenesis.

Potential Applications in Research and Vaccine Development

Pathogenesis Studies

  • Lipoproteins processed by Lgt are critical for M. gallisepticum’s survival and host interaction. Knockout studies in related bacteria confirm Lgt’s indispensability .

  • CRISPR degradation in poultry-adapted M. gallisepticum strains suggests evolutionary pressure on lipoprotein-related genes during host shifts .

Vaccine Development

  • Recombinant lipoproteins (e.g., GapA, CrmA) are being explored as subunit vaccine candidates . While Lgt itself is not yet a vaccine target, its role in generating immunogenic lipoproteins highlights its indirect importance.

  • Plant-derived multi-epitope vaccines (MEPVs) incorporating lipoprotein antigens have shown promise in poultry .

Data Tables

Table 1: Conserved Residues in Lgt Homologs

OrganismEssential ResiduesActivity Impact
Escherichia coliY26, N146, G154Complete loss
Mycoplasma gallisepticum (predicted)Y26, N146, G154Likely critical

Table 2: Lipoprotein Biosynthesis Enzymes in M. gallisepticum

EnzymeGeneFunctionStatus in M. gallisepticum
LgtlgtDiacylglyceryl transferPresent, uncharacterized
LsplspSignal peptide cleavagePresent
LntlntN-acylationAbsent

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
lgt; MYCGA7150; MGA_0597; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2))
Target Names
lgt
Target Protein Sequence
MYTTGNHTINDSFGTAFMIGSFDVRYYGILYATGILVAIIAGILTLKYKYKVDDNPYFYY VFIGIISIIFGARTWSFIIGDSIVGVTPFFAIHQGGLAIQGGVIFTITTGLIFFFFILRK PKYYVKKNYLVYENHNLVTKTFYKQASMWIYADAIIPTILIGQAIGRWGNFFNHEVYGQG LTAEQALNQWGFLKVLMPGVFEHMFINENGVTLFRVPIFLIESFFNVIAFIIIVFLLDFV KELKTGGRTMLYFFTTGIIRLIIETQRDSQFKFVTSIVTSVLFLLGGSIGFIFTQWIFPR FRNKKNYFFLFNKVKIYFIGLFKNYLNKYKNLTKEEIRKKLEPSSTIYSKNFSEMFFYAD DYDLMIKKD
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the first step in the formation of mature lipoproteins.
Database Links

KEGG: mga:MGA_0597

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma gallisepticum and why is it significant in research?

Mycoplasma gallisepticum (MG) is an avian respiratory pathogen responsible for chronic respiratory disease in chickens and infectious sinusitis in turkeys. This pathogen causes significant global economic losses to the poultry industries through reduced egg production, decreased weight gain, and increased medication costs . As a member of the Mycoplasma genus, it is characterized by the absence of a cell wall, small genome size, and limited metabolic capabilities.

The significance of M. gallisepticum in research stems from its status as a model organism for studying minimal bacterial pathogenesis and its economic importance. Current control measures, including live-attenuated and bacterin vaccines, provide some protective immunity but exhibit suboptimal efficacy, utility, or safety . This has driven research into alternative approaches such as subunit vaccines and targeted antimicrobial development focusing on essential bacterial proteins like Lgt.

What is prolipoprotein diacylglyceryl transferase (Lgt) and what function does it serve?

Prolipoprotein diacylglyceryl transferase (Lgt) is an essential enzyme that catalyzes the first step in the biogenesis of bacterial lipoproteins, which play crucial roles in bacterial growth and pathogenesis . Specifically, Lgt catalyzes the attachment of a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved +1 position cysteine in preprolipoproteins via a thioether bond .

This biochemical reaction is part of a three-step process of lipoprotein maturation. After secretion through the inner membrane via the Sec or Tat pathways, preprolipoproteins containing a signal peptide followed by a conserved lipobox sequence ([LVI][ASTVI][GAS]C) are modified by Lgt . Subsequently, prolipoprotein signal peptidase (LspA) cleaves off the signal peptide, and in Gram-negative bacteria, lipoprotein N-acyl transferase (Lnt) adds a third acyl chain to complete the mature lipoprotein .

The enzymatic function of Lgt is essential for bacterial viability in most species studied, making it an attractive target for antimicrobial development. Inhibition of Lgt leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics .

How does Lgt differ between Mycoplasma gallisepticum and other bacterial species?

While the search results don't provide specific information about differences between M. gallisepticum Lgt and that of other bacterial species, we can infer several key points based on general mycoplasma biology:

  • Membrane localization: Unlike gram-negative bacteria where Lgt functions in the inner membrane and lipoproteins are then transported to the outer membrane, M. gallisepticum is a wall-less bacterium with only a single plasma membrane. This means Lgt-processed lipoproteins remain anchored in the single membrane, potentially serving different functional roles.

  • Substrate specificity: The lipobox sequence recognized by Lgt may have subtle differences in M. gallisepticum compared to other bacteria, reflecting adaptation to its unique ecological niche and membrane composition.

  • Evolutionary adaptation: As mycoplasmas are considered evolutionarily reduced organisms, their Lgt may represent a minimal functional version of the enzyme, potentially lacking regulatory domains or features present in more complex bacteria.

Comparative genomic and biochemical studies would be necessary to fully characterize these differences, presenting an opportunity for research into the evolutionary adaptation of essential bacterial systems.

What are the optimal methods for expressing recombinant M. gallisepticum Lgt?

The expression of recombinant M. gallisepticum Lgt presents several challenges due to its nature as a membrane-bound enzyme and potential toxicity when overexpressed. Based on techniques used for similar bacterial membrane proteins, the following methodological approach is recommended:

  • Expression system selection: E. coli BL21(DE3) strains with tightly regulated promoters (like T7lac) are often suitable for potentially toxic membrane proteins. For M. gallisepticum Lgt, consideration should be given to codon optimization given the significant difference in codon usage between mycoplasmas and E. coli.

  • Construct design: Including purification tags (His6 or Strep) at the C-terminus is generally preferred to avoid interference with the N-terminal membrane-targeting sequences. Solubility-enhancing fusion partners such as MBP (maltose-binding protein) or SUMO may increase expression yields.

  • Expression conditions: Lower temperatures (16-25°C), reduced inducer concentrations, and extended expression times (overnight) generally yield better results for membrane proteins. A comparison of different induction conditions might include:

TemperatureIPTG ConcentrationInduction TimeExpected Outcome
37°C1.0 mM3-4 hoursHigher expression but risk of inclusion bodies
25°C0.5 mM6-8 hoursModerate expression with improved folding
16°C0.1-0.2 mM16-18 hoursSlower expression with optimal folding
  • Membrane extraction: Gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are typically effective for extracting active membrane proteins without denaturation.

The biochemical assay described in search result , which measures the release of glycerol phosphate as a byproduct of the Lgt-catalyzed reaction, could be adapted to verify the functionality of the recombinant enzyme.

What purification strategies yield active recombinant M. gallisepticum Lgt?

Purification of active recombinant M. gallisepticum Lgt requires careful consideration of the enzyme's membrane-associated nature. The following purification strategy is recommended:

  • Membrane fraction isolation: After cell lysis, differential centrifugation separates the membrane fraction (typically 100,000 x g pellet) containing the recombinant Lgt.

  • Detergent solubilization: Gentle, non-ionic detergents are preferred for extracting membrane proteins while maintaining their native conformation. A systematic approach comparing different detergents is advisable:

DetergentConcentration RangeAdvantagesLimitations
DDM0.5-1.0%Mild, maintains enzyme activityMay co-extract other membrane proteins
Digitonin0.5-1.0%Preserves protein-protein interactionsExpensive, variable quality
LMNG0.01-0.05%High stability, low CMCLimited literature on Lgt purification
  • Affinity chromatography: Using the engineered affinity tag (His6 or Strep) as the first purification step. All buffers should contain detergent above its critical micelle concentration (CMC) to maintain protein solubility.

  • Size exclusion chromatography: As a polishing step to remove aggregates and ensure homogeneity.

  • Activity verification: The coupled luciferase assay described in search result can be adapted to verify enzymatic activity by measuring the release of glycerol-3-phosphate as Lgt catalyzes the reaction.

Importantly, purification buffers should mimic the physiological conditions of M. gallisepticum, typically including 150-300 mM NaCl and maintaining pH around 7.0-7.5. The addition of glycerol (10-20%) can enhance protein stability during storage.

How can enzymatic activity of recombinant M. gallisepticum Lgt be measured?

Based on the search results, a reliable method for measuring Lgt enzymatic activity involves quantifying the release of glycerol phosphate, which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . This method can be adapted specifically for M. gallisepticum Lgt using the following approach:

  • Substrate preparation:

    • Phosphatidylglycerol as the lipid donor

    • Synthetic peptide substrate derived from an M. gallisepticum lipoprotein containing the conserved lipobox and cysteine residue (e.g., based on VlhA lipoproteins mentioned in result )

  • Reaction conditions:

    • Buffer: Typically 50 mM HEPES pH 7.5, 150 mM NaCl, detergent (0.05% DDM)

    • Temperature: 37°C (physiological for M. gallisepticum)

    • Reaction time: 30-60 minutes

  • Detection method:

    • A coupled luciferase reaction as described in result can detect the released glycerol-3-phosphate (G3P)

    • The detection system involves G3P oxidation by glycerol-3-phosphate oxidase, producing hydrogen peroxide, which is used by horseradish peroxidase to convert a pro-luminescent substrate to a luminescent form

  • Controls and validation:

    • Negative control: A mutant peptide substrate with the conserved cysteine mutated to alanine

    • Positive control: Characterized Lgt from E. coli or other well-studied organisms

    • Inhibition control: Known Lgt inhibitors such as those described in result (G9066, G2823, G2824)

This assay allows for quantitative determination of Lgt activity through IC50 measurements and can be used to assess the effects of potential inhibitors, substrate modifications, or enzyme mutations.

How can recombinant M. gallisepticum Lgt contribute to vaccine development?

Recombinant M. gallisepticum Lgt could contribute significantly to vaccine development through several avenues:

  • As a vaccine antigen: Lgt is a conserved, essential enzyme that could serve as an antigen in subunit vaccines. The search results indicate successful development of a subunit vaccine for M. gallisepticum using other recombinant proteins . A similar approach could be applied with Lgt, particularly if it proves to be immunogenic and accessible to the immune system during infection.

  • As a tool for lipoprotein production: Recombinant Lgt could be used to produce lipidated proteins in vitro that better mimic the native bacterial lipoproteins. The search results mention variable lipoprotein hemagglutinins (VlhAs) as components of a successful subunit vaccine . Using recombinant Lgt to ensure proper lipidation of these antigens could enhance their immunogenicity.

  • Adjuvant development: Bacterial lipoproteins are known to stimulate innate immunity through Toll-like receptor 2 (TLR2). Recombinant Lgt could be used to create defined lipoproteins with adjuvant properties to enhance vaccine responses.

The rationally designed subunit vaccine approach described in search result demonstrated significant reductions in both M. gallisepticum recovery and tracheal pathology when formulated with CpG oligodeoxynucleotide (CpG ODN 2007). This suggests that properly designed subunit vaccines can be efficacious, and the inclusion of essential enzymes like Lgt could potentially broaden the protective immune response.

What is the potential of M. gallisepticum Lgt as an antimicrobial target?

M. gallisepticum Lgt presents significant potential as an antimicrobial target based on several key factors:

  • Essential enzymatic function: The search results indicate that Lgt is essential for bacterial viability. Depletion of Lgt in E. coli leads to "permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics" . This suggests that inhibiting Lgt in M. gallisepticum would likely have detrimental effects on bacterial survival.

  • Unique resistance profile: Unlike inhibitors of other steps in lipoprotein biosynthesis, Lgt inhibitors may be less susceptible to resistance development. The search results indicate that "deletion of the major outer membrane lipoprotein, lpp, is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors" . This suggests a higher barrier to resistance development.

  • Existing proof of concept: The identification of Lgt inhibitors (G9066, G2823, and G2824) that potently inhibit Lgt biochemical activity in vitro and are bactericidal against wild-type bacterial strains provides proof of concept for targeting Lgt. These compounds showed IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively.

  • Selectivity potential: While Lgt is conserved across bacteria, structural differences between bacterial Lgt enzymes could potentially be exploited to develop selective inhibitors targeting M. gallisepticum specifically, reducing effects on beneficial bacteria.

The development of M. gallisepticum-specific Lgt inhibitors would require structural studies of the enzyme, high-throughput screening for inhibitor discovery, and subsequent optimization of lead compounds for specificity and pharmacokinetic properties.

How does genetic variation in lgt contribute to M. gallisepticum strain differentiation?

While the search results don't directly address genetic variation in the lgt gene among M. gallisepticum strains, we can draw insights from the strain differentiation methods presented:

  • Molecular markers for strain differentiation: Search result describes the use of recombinant DNA probes (pMG286.2 and pMG301.1) for M. gallisepticum strain differentiation. The 3.5 kb fragment pMG286.2 enabled differentiation of M. gallisepticum strains into distinct clusters . Similar approaches could be applied to study lgt gene variation across strains.

  • PCR-based differentiation: The search results mention PCR amplification using primers targeting the mgc2 gene, followed by restriction enzyme analysis using DdeI to differentiate between strains . A comparable approach targeting the lgt gene could potentially reveal strain-specific polymorphisms.

  • Sequence analysis for phylogeny: The phylogenetic analysis described in search result demonstrated that M. gallisepticum isolates from different geographic regions showed 98-100% sequence similarity in the mgc2 gene. Applying similar analyses to the lgt gene could reveal:

    • Conserved regions essential for enzyme function

    • Variable regions that might contribute to strain-specific properties

    • Potential correlations between lgt sequence variants and virulence

A comprehensive analysis of lgt sequences from diverse M. gallisepticum strains could provide insights into the evolution of this essential gene and potentially identify strain-specific markers for improved diagnostic tests or strain-specific vaccine approaches.

How can site-directed mutagenesis of M. gallisepticum Lgt inform structure-function relationships?

Site-directed mutagenesis of M. gallisepticum Lgt can provide critical insights into the enzyme's structure-function relationships through systematic analysis of key residues. Based on the information about Lgt enzymatic function in search result , the following methodological approach is recommended:

  • Identification of target residues:

    • Catalytic site residues predicted to interact with phosphatidylglycerol substrate

    • Residues in the conserved lipobox-binding pocket

    • Membrane-interacting domains

    • Residues unique to M. gallisepticum compared to other bacterial Lgt proteins

  • Mutagenesis strategy:

Mutation TypePurposeExpected Outcome
Alanine scanningIdentify essential residuesLoss of function indicates critical role
Conservative substitutionsProbe chemical requirementsPartial activity indicates flexible requirements
Non-conservative substitutionsTest structural constraintsMaintained activity suggests structural flexibility
Domain swappingInvestigate species specificityChimeric proteins reveal domain functions
  • Functional analysis:

    • Enzymatic activity measurement using the glycerol phosphate release assay

    • Substrate binding analysis through isothermal titration calorimetry

    • Membrane integration assessment

  • Structural correlation:

    • Comparing mutational effects with structural predictions or homology models

    • Potential co-crystallization of enzyme variants with substrate analogs

The research by Mao et al. and Singh et al. mentioned in search result has provided "significant insights into the potential mechanisms of diacylglyceryl modification by Lgt." Building on this work through focused mutagenesis of the M. gallisepticum enzyme would further elucidate whether Lgt inhibitors "competitively inhibit binding of the phosphatidylglycerol or prolipoprotein substrates" .

What are the challenges in developing selective inhibitors of M. gallisepticum Lgt?

Developing selective inhibitors targeting M. gallisepticum Lgt presents several significant challenges that researchers must address:

  • Structural conservation: Lgt is conserved across bacterial species, making selectivity difficult to achieve. The search results note that researchers have identified "the first ever described Lgt inhibitors that potently inhibit Lgt biochemical activity in vitro" , but these likely target conserved features of the enzyme.

  • Resistance development: While search result suggests that inhibition of Lgt "may not be sensitive to one of the most common resistance mechanisms that invalidate inhibitors of downstream steps of bacterial lipoprotein biosynthesis," other resistance mechanisms could emerge. The researchers noted they "were unable to raise on-target resistant mutants to any Lgti [Lgt inhibitor]" , suggesting a high barrier to resistance but not eliminating its possibility.

  • Technical hurdles:

    • Membrane protein challenges: As a membrane-embedded enzyme, Lgt presents difficulties for structural characterization and in vitro assays.

    • Screening limitations: High-throughput screening requires reliable, reproducible assays that may be challenging to develop for membrane proteins.

    • Pharmacokinetic barriers: Inhibitors must penetrate the unique membrane of M. gallisepticum, which lacks a cell wall.

  • Validation strategies: Researchers should consider:

    • Developing resistant mutants in laboratory conditions to predict and prevent resistance mechanisms

    • Comparing inhibitor effects across multiple bacterial species to assess selectivity

    • Testing inhibitors in combination with existing antibiotics to identify synergistic effects

The approach described in search result , using "a combination of biochemical and genetic strategies" to confirm the mechanism of action of Lgt inhibitors, provides a valuable template for validating new inhibitors targeting M. gallisepticum Lgt.

How do diagnostic methods for M. gallisepticum compare, and how might recombinant Lgt improve detection?

The search results describe several diagnostic methods for M. gallisepticum, each with distinct advantages and limitations:

  • ELISA: Serological detection of anti-M. gallisepticum antibodies is common but has limitations. Search result notes that "ELISA is the most common technique, but chances of non-specific reaction give false positive results" . In the study, serum samples showed 75% positivity for M. gallisepticum antibodies.

  • Culture-based methods: Traditional culturing is considered the "Gold Standard" but is "very laborious, expensive, time consuming due to slow growth and require very skilled staff" . Samples cultured on Frey's agar showed 18.8% positivity based on typical "fried egg-shaped colonies" .

  • PCR-based detection: Molecular detection using PCR targeting the mgc2 gene showed 37.1% positivity in one study . This method offers improved specificity over culturing, which may detect other Mycoplasma species.

A comparison of these methods revealed significant variations in detection rates:

Diagnostic MethodPositivity Rate (Breeders)Positivity Rate (Layers)Positivity Rate (Broilers)
ELISA75%70%50%
Culture26.5%21%9%
PCR (mgc2 gene)37.7%30.9%50%

Recombinant M. gallisepticum Lgt could potentially improve diagnostic methods through:

  • Antigen-based ELISA: Using purified recombinant Lgt as a capture antigen for detecting anti-Lgt antibodies in serum samples, potentially improving specificity over whole-cell antigen preparations.

  • PCR target development: Characterizing the lgt gene sequence across strains could identify conserved regions for designing universal primers and variable regions for strain-specific detection.

  • Rapid immunochromatographic tests: Developing antibodies against recombinant Lgt for incorporation into lateral flow assays for field diagnostics.

The approach described in search result , where PCR products were digested with restriction enzymes to differentiate between strains, could be adapted to target the lgt gene for improved strain differentiation in diagnostic applications.

What novel approaches could leverage recombinant M. gallisepticum Lgt for control and prevention?

Several innovative approaches could leverage recombinant M. gallisepticum Lgt for improved control and prevention strategies:

  • Engineered diagnostic platforms: Recombinant Lgt could be incorporated into biosensor technologies that detect M. gallisepticum in environmental samples. By immobilizing recombinant Lgt on sensor surfaces, antibodies present in sample fluids could be captured and quantified, potentially enabling on-farm monitoring systems.

  • Immunomodulatory interventions: Understanding how M. gallisepticum Lgt-processed lipoproteins interact with host immune receptors could lead to targeted immunomodulatory approaches. The search results indicate successful vaccine development using recombinant proteins and CpG oligodeoxynucleotide (CpG ODN 2007) , suggesting that targeting specific immune pathways can yield protective responses.

  • Competitive inhibition strategies: Rather than directly inhibiting Lgt enzymatic activity, developing substrate analogs that compete with natural lipoproteins for processing could disrupt bacterial membrane integrity without requiring complete enzyme inhibition.

  • Combinatorial approaches: Pairing Lgt-targeted interventions with other control measures could yield synergistic effects. For example, combining Lgt inhibitors with traditional antibiotics might enhance efficacy, as Lgt depletion leads to "increased sensitivity to serum killing and antibiotics" .

  • CRISPR-based antimicrobials: Designing CRISPR-Cas systems targeting the lgt gene could provide highly specific antimicrobial approaches that spare beneficial bacteria while targeting M. gallisepticum.

These innovative approaches align with the trend toward rational design seen in the subunit vaccine development described in search result , where researchers "utilized knowledge of MG biology and virulence" to develop an effective intervention strategy.

How might comparative studies of Lgt across Mycoplasma species inform evolution and adaptation?

Comparative studies of Lgt across Mycoplasma species offer a valuable window into bacterial evolution and adaptation, particularly for this minimal bacterial genus that represents one of the smallest self-replicating organisms. Such studies could address:

  • Evolutionary conservation: Analysis of Lgt sequence conservation across the Mycoplasma genus could reveal essential functional domains that have been maintained despite the reductive evolution characteristic of mycoplasmas. This would provide insights into the minimal requirements for Lgt function.

  • Host adaptation signatures: Comparing Lgt from mycoplasmas that infect different hosts (avian, swine, bovine, human) could identify adaptations specific to particular host environments. The search results mention M. gallisepticum as an avian pathogen ; comparing its Lgt to those from mycoplasmas infecting mammals might reveal host-specific features.

  • Functional diversity: Exploring whether Lgt enzymatic function varies across Mycoplasma species could indicate whether certain species have evolved specialized lipid processing capabilities related to their ecological niches.

  • Lateral gene transfer assessment: Analyzing Lgt sequence relatedness could provide evidence of horizontal gene transfer events between Mycoplasma species or from other bacterial genera, informing our understanding of bacterial genome evolution.

  • Correlation with virulence: Examining whether specific Lgt variants correlate with virulence phenotypes could identify potential determinants of pathogenicity. The search results note that M. gallisepticum causes "significant global economic losses to the poultry industries" , suggesting a relationship between its molecular machinery and virulence.

These comparative studies would complement the phylogenetic approaches described in search result , where researchers constructed evolutionary relationships based on the mgc2 gene sequence. Expanding such analyses to include essential genes like lgt would provide a more comprehensive understanding of Mycoplasma evolution.

What are the implications of Lgt inhibition for bacterial physiology beyond lipoprotein processing?

Inhibition of Lgt likely has far-reaching consequences for bacterial physiology beyond the direct disruption of lipoprotein processing, presenting complex research questions:

  • Membrane integrity alterations: Search result indicates that Lgt depletion leads to "permeabilization of the outer membrane," suggesting fundamental changes to membrane structure and function. In M. gallisepticum, which possesses only a single membrane, such effects might be even more pronounced and directly lethal.

  • Stress response activation: Disruption of essential cellular processes typically triggers bacterial stress responses. Research questions could explore which stress response pathways are activated by Lgt inhibition and whether these responses might contribute to or mitigate bacterial death.

  • Protein mislocalization effects: Unprocessed lipoproteins may accumulate or mislocalize within the cell, potentially:

    • Triggering protein quality control mechanisms

    • Forming aggregates that interfere with other cellular processes

    • Altering gene expression through regulatory feedback loops

  • Metabolic network perturbations: Lipid metabolism would be directly affected by Lgt inhibition through:

    • Accumulation of phosphatidylglycerol (the substrate)

    • Altered membrane lipid composition

    • Potential effects on lipid signaling molecules

  • Interaction with host defenses: Search result mentions "increased sensitivity to serum killing" following Lgt depletion, suggesting complex interactions with host defense mechanisms. For M. gallisepticum, which causes respiratory infections in poultry, understanding how Lgt inhibition affects interactions with host respiratory immunity could inform treatment strategies.

These research directions align with the observation in search result that "deletion of the major outer membrane lipoprotein, lpp, is not sufficient to rescue growth after Lgt depletion," indicating that the consequences of Lgt inhibition extend beyond simply preventing the maturation of individual lipoproteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.