Recombinant Mycoplasma genitalium ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase Subunit a (atpB) in Mycoplasma genitalium

ATP synthase is a membrane-bound enzyme complex responsible for ATP synthesis via oxidative phosphorylation. In M. genitalium, the atpB gene encodes subunit a, a key component of the FO_O region that facilitates proton transport. Recombinant subunit a (ratpB) is produced by cloning and expressing the atpB gene in heterologous systems like Escherichia coli, enabling biochemical and structural studies. Despite its metabolic importance, direct research on M. genitalium atpB is limited, necessitating inferences from homologs in related bacteria .

Functional Role in Mycoplasma genitalium Metabolism

  • Proton Translocation: Subunit a enables proton flow across the membrane, driving ATP synthesis. Disruption of this process would impair energy production, making it a potential therapeutic target .

  • Metabolic Constraints: M. genitalium’s minimal genome (580 kb) necessitates efficient energy utilization, emphasizing the importance of ATP synthase for survival in host environments .

Recombinant Expression and Purification Strategies

Recombinant atpB production typically involves:

  1. Cloning: Amplification of atpB from M. genitalium genomic DNA.

  2. Expression: Use of E. coli vectors (e.g., pET systems) with induction via IPTG .

  3. Purification: Affinity chromatography (e.g., His-tag) under denaturing conditions if inclusion bodies form .

Challenges:

  • Low solubility due to transmembrane domains.

  • Requirement for refolding to restore functional conformation .

Research Applications and Findings

While direct studies on M. genitalium atpB are scarce, insights from related systems highlight potential applications:

  • Antibody Production: Recombinant ATP synthase subunits (e.g., M. pneumoniae AtpD) are used in serological assays to detect pathogen-specific antibodies .

  • Structural Studies: Cryo-EM of Bacillus PS3 ATP synthase (3.0–3.2 Å resolution) provides a template for modeling M. genitalium’s enzyme .

Table 2: Comparative Analysis of ATP Synthase Subunits in Mycoplasma Species

SpeciesSubunitFunctionRecombinant Use Case
M. genitaliuma (atpB)Proton channel formationStructural/functional studies
M. pneumoniaeβ (AtpD)Catalytic nucleotide bindingSerological diagnostics

Comparative Analysis with Other Bacterial ATP Synthase Subunits

  • Escherichia coli: Subunit a mutations (e.g., Arg 210) abolish proton translocation, underscoring functional conservation .

  • Mitochondrial ATP Synthase: Subunit a homologs (e.g., yeast) share structural motifs but differ in regulatory complexity .

Challenges and Future Directions

  • Knowledge Gaps: No high-resolution structures or functional assays for M. genitalium atpB exist.

  • Therapeutic Potential: Targeting subunit a could disrupt energy metabolism, but M. genitalium’s slow growth complicates drug development .

  • Technical Advances: Single-particle cryo-EM and membrane protein refolding techniques may accelerate research .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare according to your request.
Lead Time
Delivery times may vary based on purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize the development of your specified tag.
Synonyms
atpB; MG405; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
atpB
Target Protein Sequence
MSPREIVLKETNQIDFISNQSIFDISPISGWKPFAPTDQILGIFIVFVLLLTFFIFYKLK LKKADSLKNNSYFLLLFQMLFVWVQDTTADLLGEENKKFAPYFLMLLLYIVSSNLVSLLG GISPPTSSLTFTFSLGLATFIGIVVMGIRYQRWNFFKEFAFGITVKGKKYSTFIPNPFSI LSGFAPLFSISLRLWGNILAGTVILALFYNFWIFIFSSINNQPLALSLGTVFAGLITPVL HIYFDVIAGVLQGYVFVMLTYNYWAKMRNQGLENNNASELHFKGIKVIQENI
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant M. genitalium atpB?

For successful expression of recombinant M. genitalium atpB, several expression systems can be employed, with E. coli being the most commonly used for bacterial proteins . When designing an expression system, researchers should consider:

  • Vector selection: Bacterial expression vectors such as pBs, pBluescript SK, pTrc99A, and pRIT5 are suitable options . For eukaryotic expression, vectors like pWLneo, pSV2cat, and pSVL can be utilized .

  • Fusion tags: Various tags can facilitate purification and potentially improve solubility. Tag types are typically determined during the production process based on protein characteristics .

  • Expression optimization: As a membrane protein, atpB expression may benefit from lower temperatures (16-25°C) to improve proper folding and solubility. Optimization of inducer concentration and induction timing is also critical.

  • Extraction methods: Since atpB is a membrane protein, specialized detergent-based extraction protocols are necessary to solubilize the protein while maintaining its native conformation.

A methodological approach for expression optimization would include:

  • Testing multiple expression strains (BL21(DE3), C41(DE3), C43(DE3))

  • Varying induction parameters (temperature, IPTG concentration, duration)

  • Screening different solubilization detergents

  • Comparing various affinity tags and their positions (N-terminal vs. C-terminal)

What are the optimal storage conditions for recombinant M. genitalium atpB?

Based on product information, the following storage conditions are recommended for maintaining recombinant M. genitalium atpB stability and activity:

  • Short-term storage: Store at -20°C

  • Long-term storage: Use -20°C or -80°C for extended preservation

  • Working aliquots: Can be maintained at 4°C for up to one week

  • Buffer composition: A Tris-based buffer containing 50% glycerol, specifically optimized for this protein

Important methodological considerations include:

  • Avoiding repeated freeze-thaw cycles, which can lead to protein denaturation and reduced activity

  • Preparing small aliquots of purified protein to minimize freeze-thaw events

  • Adding protease inhibitors if degradation is observed during storage

  • Validating protein activity after storage periods to ensure functionality is maintained

How can researchers verify the identity and purity of recombinant M. genitalium atpB?

Verification of recombinant M. genitalium atpB identity and purity requires a multi-method approach:

  • SDS-PAGE analysis: Should show a single predominant band at approximately 52.5 kDa, corresponding to the expected molecular weight of atpB .

  • Western blotting: Using anti-His tag antibodies (if His-tagged) or specific anti-atpB antibodies to confirm identity.

  • Mass spectrometry: Peptide mass fingerprinting or tandem MS can verify the protein sequence against the expected M. genitalium atpB sequence:

    • Tryptic digestion followed by LC-MS/MS

    • MALDI-TOF analysis for molecular weight confirmation

  • Functional assays: ATP synthase activity assays to confirm that the protein retains functional properties.

  • Circular dichroism: To verify proper folding through secondary structure analysis.

A standardized quality control protocol should include:

  • Purity assessment (>90% by densitometry from SDS-PAGE)

  • Identity confirmation by at least two independent methods

  • Batch-to-batch consistency verification

  • Endotoxin testing if the protein will be used in cell culture experiments

What techniques are available for studying the interaction between M. genitalium atpB and other ATP synthase subunits?

Investigating protein-protein interactions involving M. genitalium atpB requires specialized approaches suitable for membrane proteins:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpB to pull down interacting partners, particularly other ATP synthase subunits. This approach can identify native protein complexes.

  • Crosslinking studies: Chemical crosslinkers can stabilize transient interactions between atpB and other subunits, followed by mass spectrometry to identify crosslinked residues.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified atpB and other purified subunits.

  • Förster resonance energy transfer (FRET): Labeling atpB and potential interacting partners with fluorophores to detect proximity in live cells or reconstituted systems.

  • Bacterial two-hybrid systems: Modified for membrane proteins to detect binary interactions between atpB and other ATP synthase components.

  • Cryo-electron microscopy: For structural characterization of the intact ATP synthase complex, revealing the position and interactions of atpB within the assembly.

Methodological considerations should include:

  • Careful selection of detergents that maintain protein-protein interactions

  • Controls to distinguish specific from non-specific interactions

  • Validation of results using multiple complementary techniques

  • Comparison with known interactions of ATP synthase subunits from better-characterized organisms

How does ATP synthase function in M. genitalium differ from other bacteria due to its minimal genome?

M. genitalium possesses one of the smallest genomes of any free-living organism (~580 kb with approximately 480 protein-coding genes) , raising intriguing questions about its energy metabolism. Several key differences in ATP synthase function can be observed:

Methodological approaches to investigate these differences include:

TechniqueApplicationExpected Outcomes
Comparative biochemistryPurify ATP synthase components from M. genitalium and model bacteriaDifferences in enzymatic parameters (Km, Vmax, pH optimum)
Metabolic flux analysisUse isotope-labeled substrates to trace energy metabolismQuantification of ATP production via different pathways
Bioinformatic analysisCompare sequence conservation across speciesIdentification of uniquely conserved or divergent regions
Reconstitution experimentsReconstitute ATP synthase in liposomesFunctional comparison with ATP synthases from other species

This research has implications for understanding the minimal requirements for cellular life and could inform synthetic biology efforts to create minimal cells.

What is the role of M. genitalium atpB in pathogenesis and how might it be exploited for therapeutic development?

While not directly addressed in the search results, the essential nature of ATP synthase for bacterial survival makes atpB a potential therapeutic target. A methodological framework for investigating this includes:

  • Expression analysis during infection:

    • Measure atpB expression levels during different stages of infection

    • Compare expression in antibiotic-sensitive versus resistant strains

    • Correlate expression with virulence phenotypes

  • Target validation approaches:

    • RNA interference or antisense strategies to reduce atpB expression

    • Small molecule inhibitors of ATP synthase activity

    • Assessment of bacterial viability and virulence after targeting atpB

  • Immunological relevance:

    • Determine if atpB generates antibody responses during natural infection

    • Assess if anti-atpB antibodies have neutralizing activity

    • Evaluate atpB as a potential vaccine component

  • Drug development strategies:

    • High-throughput screening for atpB inhibitors

    • Structure-based drug design targeting unique features of M. genitalium atpB

    • Repurposing of existing ATP synthase inhibitors for M. genitalium

Potential therapeutic applications could be particularly valuable given that M. genitalium infections are becoming increasingly difficult to treat due to antibiotic resistance . ATP synthase inhibitors could represent a novel class of antimicrobials with activity against resistant strains.

How can recombinant M. genitalium atpB be used in developing diagnostic tools for M. genitalium infections?

M. genitalium causes sexually transmitted infections that are often asymptomatic but can lead to complications if left untreated . Recombinant atpB could be valuable in diagnostic development:

  • Serological assay development:

    • Similar to approaches used with M. pneumoniae ATP synthase proteins

    • ELISA-based detection of anti-atpB antibodies in patient sera

    • Western blot confirmation tests

    • Lateral flow immunochromatographic assays for point-of-care testing

  • Methodological approach for diagnostic validation:

Development PhaseActivitiesMetrics
Antigenicity assessmentTest recombinant atpB with confirmed positive and negative seraSensitivity, specificity, ROC curve analysis
Epitope mappingIdentify immunodominant regionsPeptide arrays, truncation analysis
Assay optimizationDetermine optimal conditions and cut-offsSignal-to-noise ratio, reproducibility
Clinical validationCompare with current diagnostic methodsPositive/negative predictive values
  • Advantages of atpB-based diagnostics:

    • Potential to detect past infections (serological memory)

    • Possibly less susceptible to genetic variation than surface antigens

    • Could complement nucleic acid amplification tests (NAATs)

    • May help distinguish between active and resolved infections

Current diagnostic approaches for M. genitalium primarily rely on NAATs, but these cannot distinguish past from current infections and require specialized equipment . Serological tests based on atpB could provide complementary diagnostic information, particularly for epidemiological studies.

What structural modifications of recombinant M. genitalium atpB affect its stability and activity in vitro?

Understanding the structure-function relationship of M. genitalium atpB requires systematic analysis of how modifications affect stability and activity. Though specific data is not provided in the search results, a methodological framework includes:

  • Site-directed mutagenesis studies:

    • Target predicted functional residues (proton channel, subunit interfaces)

    • Create systematic alanine scanning to map critical regions

    • Introduce mutations observed in clinical isolates to assess functional impact

  • Domain engineering approaches:

    • Generate truncated versions to identify minimal functional domains

    • Create chimeric proteins with atpB from other species

    • Introduce stabilizing modifications (e.g., disulfide bridges)

  • Post-translational modification analysis:

    • Identify native modifications (phosphorylation, acetylation)

    • Assess their impact on protein function

    • Engineer modified versions to enhance stability

A comprehensive experimental design would include:

Modification TypeExamplesStability AssessmentFunctional Assessment
Point mutationsConserved residues, clinical variantsThermal shift assays, protease resistanceATP synthesis assays, proton translocation
TruncationsN-terminal, C-terminal, loop deletionsCircular dichroism, fluorescenceSubunit binding assays, oligomerization
Fusion constructsSolubility tags, fluorescent proteinsSize exclusion chromatographyComplex assembly analysis
Buffer conditionspH, ionic strength, additivesAggregation monitoringActivity under various conditions

These studies would provide insights into critical regions of atpB for function and identify modifications that could enhance stability for structural studies or biotechnological applications.

How does the expression of atpB correlate with antibiotic resistance in M. genitalium strains?

The relationship between atpB expression and antibiotic resistance represents an unexplored but potentially significant area of research. M. genitalium infections are typically treated with antibiotics such as doxycycline and azithromycin , but resistance is increasing.

A comprehensive methodological approach would include:

  • Expression analysis in clinical isolates:

    • Compare atpB expression levels between antibiotic-sensitive and resistant strains

    • Use RT-qPCR and proteomic approaches to quantify expression

    • Correlate expression with minimum inhibitory concentrations (MICs)

  • Experimental manipulation:

    • Modulate atpB expression in laboratory strains

    • Assess changes in antibiotic susceptibility

    • Measure ATP levels and membrane potential

  • Mechanistic investigations:

    • Determine if ATP-dependent efflux pumps are affected by atpB expression

    • Investigate if membrane potential changes alter antibiotic uptake

    • Explore metabolic adaptations associated with altered ATP synthesis

Potential experimental data collection and analysis:

ParameterAntibiotic-Sensitive StrainsAntibiotic-Resistant StrainsCorrelation Analysis
atpB expression levelsBaseline measurementsComparative measurementsPearson/Spearman correlation with MICs
ATP contentQuantificationQuantificationAssociation with resistance phenotypes
Membrane potentialFluorescent probe measurementsComparative measurementsImpact on drug accumulation
Effect of ATP synthase inhibitorsGrowth inhibition analysisSynergy with antibioticsPotential for resistance reversal

This research could potentially identify:

  • Biomarkers for predicting antibiotic resistance

  • New therapeutic targets to combat resistant infections

  • Combination therapy strategies involving ATP synthase inhibitors

  • Metabolic vulnerabilities in resistant strains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.