Recombinant Mycoplasma genitalium ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for prioritized development.
Synonyms
atpF; MG403; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-208
Protein Length
Full Length of Mature Protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
atpF
Target Protein Sequence
CTENVREIKSSSVINELFPNFWVFITHLLAFFILLTLMIFLFWKPTQRFLNNRKNLLEAQ IKQANELEKQARNLLEESNQRHEKALIVSKEIVDQANYEALQLKSEIEKTANRQANLMIF QARQEIEKERRSLKEQSIKESVELAMLAAQELILKKIDQKSDREFIDKFIRDLEANETED D
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b (atpF) in Mycoplasma genitalium?

ATP synthase subunit b (atpF) in M. genitalium is part of the F₀ domain of ATP synthase, which is embedded in the cell membrane. It forms part of the stator arm that connects the F₁ catalytic domain to the membrane domain, preventing rotation of certain parts of the complex while allowing others to rotate. This structural role is essential for the complex to function as a rotary nanomotor that synthesizes ATP from ADP and inorganic phosphate using the energy provided by proton electrochemical gradient.

What are the recommended methods for cloning and expressing recombinant M. genitalium ATP synthase subunit b?

For successful expression of recombinant M. genitalium ATP synthase subunit b (atpF), researchers should consider the following methodological approach:

  • Gene identification and primer design: Based on genomic data of M. genitalium strain G37, design primers to amplify the atpF gene with appropriate restriction sites for subsequent cloning.

  • Expression vector selection: A pET-based expression system in E. coli is recommended for high-level expression. The pET vector should include an N-terminal His-tag to facilitate purification.

  • Transformation and expression: Transform the construct into an E. coli expression strain such as BL21(DE3). Culture conditions typically include induction with IPTG (0.5-1 mM) when cultures reach OD₆₀₀ of 0.6-0.8, followed by expression at 30°C for 4-6 hours to minimize inclusion body formation.

This approach is analogous to methods used for other M. genitalium proteins and the ATP synthase components from related species. For instance, the ATP synthase beta subunit (AtpD) of M. pneumoniae was successfully cloned and expressed in E. coli to obtain recombinant protein for serological studies .

What purification strategies yield the highest purity and activity of recombinant atpF protein?

Purification of recombinant M. genitalium ATP synthase subunit b requires a multi-step approach to achieve high purity while maintaining structural integrity and functional activity:

  • Initial purification by IMAC: Use immobilized metal affinity chromatography with a Ni-NTA column for His-tagged proteins. A step gradient of imidazole (20-250 mM) in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10% glycerol is recommended.

  • Secondary purification: Apply ion exchange chromatography (typically Q-Sepharose) to remove remaining contaminants.

  • Quality assessment: Evaluate purity by SDS-PAGE (>95% purity is desirable) and confirm identity by Western blotting using anti-His antibodies or mass spectrometry.

  • Functional verification: Assess the structural integrity through circular dichroism and functional activity through ATPase assays.

The purification protocol should be optimized to prevent protein aggregation, which is common with membrane-associated proteins. Including mild detergents such as 0.1% Triton X-100 or 0.05% n-dodecyl-β-D-maltoside during purification may help maintain the native conformation of the protein.

How can researchers assess the ATPase activity of purified recombinant atpF protein?

  • Reconstitution assay: Combine purified recombinant atpF with other purified ATP synthase subunits to reconstruct partial or complete complexes. The activity of these reconstituted complexes can be compared to control preparations lacking atpF.

  • ATPase activity measurement: Standard ATPase activity assays involve measuring inorganic phosphate release from ATP hydrolysis using colorimetric methods such as malachite green assay or coupled enzyme assays.

For methodology reference, researchers can adapt protocols used for other ATPases. For example, ClpB protein studies from Mycoplasma used a reaction mixture containing 25 mM HEPES-KOH (pH 7.5), 5 mM MgCl₂, 5 mM ATP, 1 mM EDTA, and 1 mM dithiothreitol with varying concentrations of the protein (0.1 μM to 10 μM) . ATPase activities can also be determined in the presence of α-casein or poly-l-lysine as potential activators or substrates.

What structural methods are most appropriate for studying the conformation of ATP synthase subunit b?

Several complementary structural biology techniques are recommended for comprehensive analysis of ATP synthase subunit b conformation:

The choice between these methods depends on specific research questions and available resources. Many structural studies combine multiple techniques to overcome the limitations of individual methods. For instance, the detailed structure of bovine mitochondrial ATP synthase subunits has been resolved by X-ray crystallography by John Walker's group , providing valuable reference data for comparative structural analysis.

How should researchers design experiments to analyze transcriptional regulation of the atpF gene in M. genitalium?

Designing robust experiments to analyze transcriptional regulation of the atpF gene requires careful consideration of multiple approaches:

  • RNA extraction optimization: For M. genitalium, use Tri Reagent (Sigma) followed by RNeasy mini kit (Qiagen) processing to remove RNAs less than 200 nt, as described for M. genitalium transcriptional studies . Add RNase inhibitor (e.g., RNaseOUT) to stabilize RNA samples.

  • RT-qPCR analysis: Design gene-specific primers for atpF and appropriate reference genes. Validate primer efficiency using five serial 10-fold dilutions of M. genitalium genomic DNA (10⁸–10⁴ copies per reaction) to achieve R² >0.99 . For cDNA preparation, reverse transcribe 1 μg DNase I-treated RNA with SuperScript Reverse Transcriptase II.

  • Microarray analysis: An oligonucleotide-based microarray approach can be employed for genome-wide transcriptional analysis. Oligonucleotides (70-mers) representing the complete set of M. genitalium ORFs should be printed on slides, with empty spots included as negative controls .

  • RNA-Seq: For more comprehensive analysis, RNA-Seq can provide greater sensitivity and dynamic range than microarrays. This approach is particularly valuable for identifying novel transcripts and alternative start sites.

For studying condition-specific regulation, researchers should design experiments that compare atpF expression under different conditions, such as varying energy states, growth phases, or stress conditions.

What are the best methods to study protein-protein interactions involving ATP synthase subunit b in M. genitalium?

To elucidate the protein-protein interactions of ATP synthase subunit b in M. genitalium, several complementary approaches are recommended:

  • Co-immunoprecipitation (Co-IP): Using antibodies against atpF to pull down interaction partners, followed by mass spectrometry identification. This requires either generating specific antibodies against recombinant atpF or using epitope-tagged versions of the protein.

  • Bacterial two-hybrid system: Adapting bacterial two-hybrid systems for examining specific predicted interactions between atpF and other ATP synthase subunits.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking of intact cells or isolated membranes followed by mass spectrometry to identify proteins in close proximity to atpF.

  • Surface plasmon resonance (SPR): For quantitative analysis of binding affinities between purified atpF and other proteins or subunits.

  • Förster resonance energy transfer (FRET): Using fluorescently labeled proteins to detect interactions in vivo or in reconstituted systems.

These methods can help establish the assembly pathway of the ATP synthase complex in M. genitalium, which is presumed to follow a pattern similar to other bacteria where assembly proceeds from the c-ring, followed by binding of F₁, the stator arm, and finally subunits a and A6L .

How can metabolic modeling approaches incorporate ATP synthase subunit b expression data to predict cellular energy dynamics?

Integrating ATP synthase subunit b expression data into metabolic models requires sophisticated computational approaches that can connect transcriptional or proteomic data with flux predictions:

Table 2: Predicted Impact of ATP Synthase Modulation on M. genitalium Metabolism

ParameterNormal ExpressionReduced ExpressionOverexpression
ATP production rateBaselineDecreasedIncreased*
Growth rateBaselineDecreasedMinimal change**
Central carbon fluxBaselineRedirectedMinimal change
Redox balanceBalancedImbalancedPotentially imbalanced

*Assuming sufficient substrate availability and proton motive force
**Limited by other factors in minimal genome

The model-based predictions can guide experimental design for testing hypotheses about the role of ATP synthase in cellular energy dynamics, particularly in a minimal genome context like M. genitalium .

What are the challenges and solutions for studying the role of ATP synthase subunit b in antimicrobial resistance mechanisms?

Studying ATP synthase subunit b in the context of antimicrobial resistance presents several unique challenges and requires specialized approaches:

  • Challenge: Limited genetic manipulation tools for M. genitalium

    • Solution: Utilize heterologous expression systems or synthetic biology approaches to create chimeric systems where M. genitalium atpF replaces its counterpart in more genetically tractable organisms.

  • Challenge: Difficulty in distinguishing direct effects on ATP synthase from secondary metabolic effects

    • Solution: Employ metabolomic approaches to track energy metabolites in parallel with transcriptomic and proteomic measurements following antimicrobial exposure.

  • Challenge: Low-throughput nature of traditional ATP synthase assays

    • Solution: Develop high-throughput screening methods using fluorescent ATP analogs or membrane potential indicators to rapidly assess the impact of compounds on ATP synthase function.

  • Challenge: The small genome of M. genitalium limits redundancy and compensatory mechanisms

    • Solution: This can actually be advantageous for research, as it allows clearer interpretation of cause-effect relationships. Comparative studies with more complex organisms can highlight these differences.

Research into ATP synthase as an antimicrobial target is particularly promising because this enzyme complex is essential for microbial survival and has structural features distinct from human ATP synthases. Specific inhibitors targeting bacterial-specific regions of atpF could potentially lead to new classes of antimicrobials with reduced side effects.

How can researchers design experiments to understand the evolutionary significance of ATP synthase subunit b in minimal genome organisms?

Designing experiments to investigate the evolutionary significance of ATP synthase subunit b in minimal genome organisms like M. genitalium requires multifaceted approaches:

  • Comparative genomics and phylogenetics:

    • Analyze sequence conservation of atpF across different Mycoplasma species and other minimal genome organisms

    • Identify conserved domains that may represent the minimal functional core

    • Construct phylogenetic trees to trace the evolutionary history of this subunit

  • Structure-function analysis through domain swapping:

    • Create chimeric proteins by swapping domains between atpF from minimal genome organisms and those from more complex bacteria

    • Express these chimeras in appropriate host systems and assess functional complementation

    • Map the minimal functional domains required for ATP synthase assembly and function

  • Experimental evolution studies:

    • Subject M. genitalium to long-term cultivation under different selective pressures

    • Sequence the atpF gene from evolved populations to identify adaptive mutations

    • Characterize the functional consequences of these mutations

  • Synthetic biology approaches:

    • Design and test minimal versions of atpF to determine the shortest functional sequence

    • Incorporate non-natural amino acids to probe specific functional sites

    • Develop orthogonal ATP synthase systems to test evolutionary hypotheses

These experimental approaches can provide insights into how essential cellular machinery like ATP synthase has been optimized through evolution in organisms with minimal genomes. The findings may reveal fundamental principles of molecular evolution and energy conservation that extend beyond Mycoplasma to all living systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.