Recombinant Mycoplasma genitalium ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mycoplasma genitalium ATP Synthase Subunit c (atpE)

Recombinant Mycoplasma genitalium ATP synthase subunit c (atpE) is a bioengineered protein derived from the F₀ sector of the ATP synthase complex. It plays a critical role in proton translocation across mitochondrial membranes in eukaryotes and bacterial bioenergetic processes. In M. genitalium, this protein is essential for ATP production via glycolysis, as the bacterium lacks respiratory chains and relies solely on fermentation for energy .

The recombinant form is produced in E. coli with a His-tag for purification, spanning the full-length sequence (1–102 amino acids) . While structural data for M. genitalium atpE is limited, studies on homologous proteins (e.g., human and yeast subunit c) reveal a conserved cylindrical structure critical for proton pumping .

Expression and Refolding

The recombinant atpE is expressed in E. coli under optimized conditions for solubility. Key steps include:

  1. Cloning: Insertion of the atpE gene into a plasmid vector (e.g., pET series) with a His-tag.

  2. Induction: IPTG-induced overexpression at 16–20°C to reduce inclusion body formation .

  3. Purification:

    • Ni²⁺ affinity chromatography: Binds His-tagged protein.

    • Size-exclusion chromatography: Ensures monodispersity.

Quality Control

ParameterSpecificationMethod
Purity>90% (SDS-PAGE)Coomassie staining
Concentration0.1–1.0 mg/mL (reconstituted in deionized water)Bradford assay
Storage-20°C/-80°C (lyophilized powder)Aliquoting recommended

Data from commercial suppliers indicate high yield and stability, making it suitable for structural studies or functional assays .

Functional Studies

In M. genitalium, ATP synthase is critical for survival due to its reliance on glycolysis . Recombinant atpE could elucidate:

  • Proton-translocating efficiency: Mutagenesis studies to map critical residues.

  • Drug targets: Screening inhibitors of ATP synthase to combat antibiotic-resistant strains.

Comparative Insights

OrganismSubunit c LengthKey FeaturesReference
Homo sapiens (P1/P2/P3)76 aa (mature)Isoforms with distinct targeting peptides
Enterococcus hirae71 aaHis-tagged recombinant for structural studies
M. genitalium102 aaFull-length mature protein; no targeting peptide

Challenges and Future Directions

  • Limited Functional Data: Most studies focus on eukaryotic or other bacterial systems (e.g., E. coli, Enterococcus).

  • Antigenic Potential: M. genitalium’s atpE may evade host immunity due to low homology with human proteins, making it a candidate for vaccine development .

  • Therapeutic Targeting: Inhibiting ATP synthase could disrupt M. genitalium’s energy metabolism, but requires further validation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpE; MG404; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
atpE
Target Protein Sequence
MEHVNEILATVGVILQQTQTTQDVNASAKLGAYIGAGVTMIAGSTVGIGQGYIFGKAVEA IARNPEVEKQVFKLIFIGSAVSESTAIYGLLISFILIFVAGA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the F(0) channel and directly participates in transmembrane translocation. A homomeric c-ring composed of 10-14 subunits forms the central stalk rotor element, interacting with the F(1) delta and epsilon subunits.
Database Links
Protein Families
ATPase C chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.