Recombinant Mycoplasma genitalium Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

YidC is a conserved membrane protein insertase found in bacteria, including Mycoplasma genitalium. The recombinant form is typically expressed in E. coli, purified, and tagged (e.g., His-tag) for structural and functional studies. Key characteristics include:

FeatureDetailsSource
Source OrganismMycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Expression HostE. coli ,
TagN-terminal His-tag
LengthFull-length (1–385 amino acids)
Purity>90% (SDS-PAGE)

Key Applications:

  • Structural studies (e.g., cryo-EM, molecular dynamics simulations).

  • Functional assays to study membrane protein insertion.

  • Therapeutic research targeting M. genitalium pathogenicity.

Functional Mechanisms

  1. Co-Translational Insertion: Binds the ribosome at the exit tunnel to guide nascent polypeptides into the membrane .

  2. Substrate Binding: Interacts with hydrophobic regions of target proteins via aromatic residues in TM3 and TM5 .

  3. Hydrophilic Environment: A polar region on the cytoplasmic side may stabilize polar termini of substrates during translocation .

Key Interactions:

  • Ribosome Interface: Docking studies reveal binding near the ribosomal tunnel exit .

  • Membrane Interface: Hydrophobic mismatch between YidC’s TM helices and lipids drives bilayer deformation .

Functional Assays

  • Membrane Thinning: Hydrophobic mismatch induces bilayer deformation, enabling efficient substrate insertion .

  • Cytokine Modulation: In M. genitalium infections, YidC may influence host immune responses (e.g., IL-6 levels) .

Challenges and Future Directions

  • Culturing Limitations: M. genitalium’s fastidious growth necessitates recombinant systems for YidC study .

  • Mechanistic Gaps: Exact roles in protein folding and immune evasion remain unclear .

  • Therapeutic Targets: YidC’s conservation across bacteria makes it a candidate for broad-spectrum antimicrobial strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please contact your local distributors for specific delivery time information.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage state, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
yidC; MG464; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
yidC
Target Protein Sequence
MPIKLAQTNKEIKTTFNPFWSAAVVNEKNNWKNFKKFSAIFIKVIKVFIFIFLTIVGLWG CTQTLAQPWTGTNQVLGSGLEIGYKFGTTGDYRYDLISNNFGPYFTFSDYTLAYGPFYGW FVWPAAQIVLPIMYATRVPLGSGVELGFNMILSLIVLLLLVRLITIVITLNSTLALEKMN EVQGKLAEINAKYKGAIDLQSKRNRQLEIMSLYKKHNIKSSAAFVQVFVTLPIFLIIYRI VTTLRPIKAIILFNFWDLSKVPLTEIFSNFTTTGWPFIIFLVIVLPVQFLSQKLPQVWAS KRNENAKAHSQKSIEQLNKTKKMQLIFYFVFAAITAFSAAGVGVYWFLNALFTLLQSYLT HVFIVKRREKRKQNYSKLDLILERE
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins within the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC in bacterial membrane protein insertion?

YidC is a bacterial membrane protein that plays a critical role in the integration process of newly synthesized proteins into the membrane. It functions to recognize hydrophobic regions of membrane proteins and catalyze their integration in a transmembrane orientation into the membrane bilayer. YidC can function both in conjunction with the Sec translocase and independently for Sec-independent membrane proteins . Experimental evidence demonstrates that YidC is sufficient on its own to promote the membrane insertion of Sec-independent proteins, such as the Pf3 coat protein, suggesting that YidC constitutes a novel translocase system that operates separately from the classical Sec machinery .

How does YidC relate to similar proteins in other organelles?

YidC belongs to an evolutionarily conserved family of membrane protein insertases with homologues present in mitochondria (Oxa1p) and chloroplasts (Alb3). These homologous proteins are involved in the membrane insertion of specific subsets of proteins in their respective organelles . The mitochondrial homolog Oxa1p is particularly important as it plays a central role in inserting proteins from the matrix into the mitochondrial inner membrane, functioning in the absence of Sec translocase components which mitochondria lack . This evolutionary conservation highlights the fundamental importance of YidC-like insertases across different biological systems.

What is Mycoplasma genitalium and why is it significant in research?

Mycoplasma genitalium is a sexually transmitted pathogen that can cause various reproductive tract diseases in both men and women . It has gained significant research interest due to its association with reproductive health complications. Understanding the relationship between M. genitalium infection and subsequent reproductive health problems requires accurate diagnostic and serological tools . The bacterium presents unique research challenges, particularly in developing specific serological tests due to extensive cross-reactivity with the closely related respiratory tract pathogen Mycoplasma pneumoniae .

What is the significance of membrane protein integration in bacterial systems?

Membrane protein integration is a fundamental cellular process essential for bacterial survival and function. In bacterial systems, proteins can be integrated into the membrane through different pathways: the Sec-dependent pathway and Sec-independent pathways (including YidC-mediated insertion) . Understanding these integration mechanisms is crucial for comprehending bacterial physiology, designing antimicrobial agents, and developing protein expression systems. The YidC-mediated pathway is particularly important for proteins that do not require the classical Sec machinery, demonstrating the versatility of bacterial membrane integration systems .

How can YidC be effectively reconstituted into proteoliposomes for functional studies?

For successful reconstitution of YidC into proteoliposomes, researchers should follow a systematic protocol:

  • Purify YidC protein using appropriate affinity chromatography and detergent solubilization techniques.

  • Prepare liposomes with a composition mimicking the bacterial inner membrane.

  • Incorporate YidC into liposomes at the optimal protein:lipid ratio of approximately 1:25,000 (equivalent to about 25 YidC molecules per liposome) for maximum functional efficiency .

  • Verify correct orientation of reconstituted YidC using protease protection assays - properly oriented YidC should yield a 42 kDa trypsin-resistant fragment corresponding to the periplasmic domain between the first two transmembrane regions .

  • Establish a membrane potential across the proteoliposomes using potassium diffusion potential with valinomycin if studying potential-dependent insertion processes.

The functionality of reconstituted YidC can be assessed by measuring the insertion efficiency of model substrates such as the Pf3 coat protein. Efficient reconstitution typically allows for the insertion of approximately 150 Pf3 coat protein molecules per YidC molecule, demonstrating the catalytic nature of the insertion reaction .

What are the methodological considerations for distinguishing between YidC-dependent and YidC-independent membrane insertion?

To effectively distinguish between YidC-dependent and YidC-independent membrane insertion pathways, researchers should consider the following methodological approaches:

  • In vivo depletion studies using inducible expression systems (such as the araBAD promoter) to control YidC levels in bacterial cells .

  • In vitro comparison of membrane insertion into proteoliposomes with and without reconstituted YidC under identical conditions.

  • Time-course analysis to determine insertion kinetics, as YidC typically accelerates the insertion process even for proteins that can insert independently .

  • Protein substrate engineering to modify hydrophobic domains - extended hydrophobic regions (like in the 3L-Pf3 mutant) can enable YidC-independent insertion that occurs with similar efficiency in both YidC-containing and YidC-deficient membranes .

  • Membrane potential dependency analysis, as some YidC-dependent proteins require a membrane potential for efficient insertion, while YidC-independent insertion (like 3L-Pf3) can occur efficiently without a membrane potential .

The data interpretation should consider that some proteins may show "autonomous" membrane insertion in vitro at low efficiency but still require YidC in vivo for physiologically relevant insertion rates. The 3L-Pf3 mutant provides an excellent control substrate, as it inserts efficiently even in YidC-depleted conditions .

What approaches are most effective for developing specific serological assays for Mycoplasma genitalium detection?

Developing specific serological assays for M. genitalium faces a significant challenge due to cross-reactivity with M. pneumoniae. Based on recent research advances, the following methodological approaches have proven effective:

  • Recombinant protein-based immunoblot assays: Using a recombinant fragment of the M. genitalium MG075 protein present in lipid-associated membrane extracts has yielded promising results with 87.1% sensitivity and 95.2% specificity .

  • Careful selection of control populations:

    • Positive controls should include PCR-confirmed M. genitalium infections (101 adults in the referenced study)

    • Negative controls should include children under 15 years (unlikely to have been exposed to sexually transmitted M. genitalium) both with and without M. pneumoniae infection (166 children in the referenced study) .

  • Cross-reactivity elimination strategies:

    • Identification of M. genitalium-specific epitopes absent in M. pneumoniae

    • Absorption techniques to remove cross-reactive antibodies

    • Two-stage testing algorithms to increase specificity

The successful immunoblot assay described achieved high sensitivity (87.1%) and specificity (95.2%), representing a significant improvement in distinguishing between these closely related mycoplasma species .

How can researchers quantitatively determine the membrane insertion efficiency of proteins in YidC proteoliposome systems?

For quantitative assessment of membrane insertion efficiency in YidC proteoliposome systems, researchers should implement the following methodological approaches:

  • Protease protection assays: Treat the proteoliposomes with proteinase K to digest non-inserted portions of the protein. Properly inserted transmembrane segments remain protected from protease digestion .

  • Quantitative analysis workflow:

    • Add purified substrate protein (e.g., Pf3 coat protein) to energized YidC proteoliposomes

    • Incubate at 37°C for desired time intervals

    • Stop the reaction by chilling and adding proteinase K

    • Separate proteoliposomes by centrifugation

    • Analyze protected fragments by SDS-PAGE and quantify using densitometry

  • Controls to include:

    • Detergent-solubilized proteoliposomes (should show complete protein digestion)

    • Liposomes without YidC (to determine baseline autonomous insertion)

    • Proteoliposomes without membrane potential (to assess potential-dependency)

  • Time-course analysis: Monitor insertion at multiple time points (0-30 minutes) to determine insertion kinetics and calculate insertion rates .

The experimental data can be presented in table format showing insertion efficiency as a function of:

  • YidC concentration (protein:lipid ratio ranging from 1:5,000 to 1:200,000)

  • Incubation time (0-30 minutes)

  • Membrane potential (presence/absence)

  • Substrate protein variants (wild-type vs. mutants)

What are the technical challenges in studying the topology of YidC and how can they be addressed?

Determining the precise topology of membrane proteins like YidC presents several technical challenges that can be addressed through complementary approaches:

  • Protease accessibility mapping:

    • Reconstitute YidC in proteoliposomes with controlled orientation

    • Treat with proteases (trypsin or proteinase K)

    • Analyze protected fragments using domain-specific antibodies

    • The 42 kDa trypsin-resistant fragment observed indicates the periplasmic domain is protected inside the liposome, confirming correct orientation

  • Transmembrane domain prediction and verification:

    • Computational prediction of transmembrane segments

    • Site-directed mutagenesis to introduce reporter epitopes or cysteine residues

    • Accessibility studies using membrane-permeable and non-permeable reagents

  • Fusion protein approach:

    • Create hybrid proteins with reporter domains (e.g., GFP, alkaline phosphatase)

    • The activity/fluorescence of the reporter indicates the topology of the fusion site

  • Structural biology techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy for specific domains

A critical control is comparing results from reconstituted systems with those from native membrane vesicles. In inverted membrane vesicles, a similar 42 kDa protease-resistant fragment is observed after protease treatment, validating the reconstitution approach .

How should researchers design experiments to determine the optimal YidC concentration for membrane protein insertion?

To determine the optimal YidC concentration for membrane protein insertion, researchers should adopt a systematic titration approach:

  • Preparation of proteoliposomes with varying YidC concentrations:

    • Create a dilution series of purified YidC protein for reconstitution

    • Test protein:lipid ratios ranging from 1:5,000 to 1:200,000 (corresponding to approximately 5-120 YidC molecules per liposome)

    • Maintain consistent lipid composition and vesicle size across all samples

  • Standardized insertion assay:

    • Use purified substrate protein (e.g., Pf3 coat protein) at constant concentration

    • Maintain uniform reaction conditions (temperature, buffer composition, incubation time)

    • Assess insertion efficiency through protease protection assays

  • Data analysis and presentation:

    • Plot insertion efficiency against YidC concentration

    • Determine the threshold concentration required for significant insertion

    • Identify the concentration yielding maximum insertion efficiency

The experimental evidence indicates that approximately 25 YidC molecules per liposome (protein:lipid ratio of 1:25,000) provides optimal insertion efficiency, reaching approximately 70% of the applied Pf3 protein . Interestingly, efficiency slightly decreases at higher YidC concentrations (>50 molecules per liposome), suggesting potential self-interference at extremely high densities .

What controls are essential when investigating YidC-mediated membrane insertion?

Robust experimental design for YidC-mediated membrane insertion studies requires several essential controls:

  • Negative controls:

    • Protein-free liposomes to assess spontaneous insertion

    • Heat-inactivated YidC to confirm enzymatic activity

    • Proteoliposomes without membrane potential when studying potential-dependent insertion

  • Positive controls:

    • Known YidC substrate (e.g., Pf3 coat protein)

    • Modified substrates with enhanced insertion properties (e.g., 3L-Pf3 mutant)

  • Orientation and integrity controls:

    • Protease protection assays to verify YidC orientation (42 kDa fragment indicates correct orientation)

    • Detergent treatment of proteoliposomes to confirm complete protease accessibility when membranes are disrupted

  • Substrate-specific controls:

    • For C-terminally extended substrates (e.g., Pf3-P2), use domain-specific antibodies to verify correct topology

    • Demonstrate protection of N-terminal fragment (~6 kDa) but degradation of C-terminal extension

  • In vivo validation:

    • Parallel YidC depletion studies in bacterial systems

    • Comparison of in vitro results with in vivo phenotypes to ensure physiological relevance

How can researchers accurately assess cross-reactivity when developing serological assays for Mycoplasma genitalium?

Developing accurate serological assays for M. genitalium requires rigorous assessment of cross-reactivity, particularly with M. pneumoniae. Researchers should implement the following methodological approaches:

  • Systematic assessment of test populations:

    • Adults with PCR-confirmed M. genitalium infection (positive cases)

    • Adults with PCR-confirmed M. pneumoniae infection without M. genitalium

    • Children under 15 years with M. pneumoniae infection (unlikely to have M. genitalium exposure)

    • Children under 15 years without any mycoplasma infection

  • Molecular strategies to reduce cross-reactivity:

    • Identify species-specific proteins or protein fragments (like the MG075 protein fragment)

    • Express recombinant proteins in heterologous systems

    • Perform epitope mapping to identify unique antigenic regions

  • Technical approaches:

    • Pre-absorption of sera with heterologous antigens

    • Two-step testing protocols

    • Differential signal analysis comparing reactions to both species' antigens

  • Statistical analysis:

    • Calculate sensitivity and specificity with 95% confidence intervals

    • Determine positive and negative predictive values for defined population prevalence

    • Apply receiver operating characteristic (ROC) analysis to optimize cutoff values

When developing the immunoblot assay based on recombinant M. genitalium MG075 protein fragment, researchers achieved 87.1% sensitivity based on testing antibody responses in sera from 101 adults with PCR-confirmed M. genitalium infection, and 95.2% specificity through evaluation of sera from 166 children under 15 years with and without M. pneumoniae infection .

How do researchers reconcile differences between in vitro and in vivo membrane insertion efficiency?

Researchers may observe discrepancies between in vitro and in vivo membrane insertion efficiency. These differences can be systematically addressed through the following analytical framework:

  • Analysis of differing experimental conditions:

    • Lipid composition differences between artificial liposomes and bacterial membranes

    • Protein crowding effects present in vivo but absent in minimalist in vitro systems

    • Additional cellular factors that may be missing in reconstituted systems

  • Resolution of apparent contradictions:

    • The Pf3 coat protein shows low-efficiency autonomous insertion into liposomes in vitro but requires YidC in vivo

    • The 3L-Pf3 mutant inserts efficiently both in vitro and in vivo, even in YidC-depleted conditions

    • These observations suggest that the in vitro system may permit thermodynamically favorable but kinetically slow insertions that would be physiologically irrelevant in vivo

  • Methodological reconciliation:

    • Perform time-course analyses to distinguish kinetic from thermodynamic effects

    • Compare rate constants rather than endpoint measurements

    • Introduce cellular extracts to in vitro systems to identify missing factors

  • Biological interpretation:

    • YidC likely functions as a catalyst that dramatically increases insertion rates

    • For some substrates (wild-type Pf3), this catalysis is essential for physiologically relevant insertion rates

    • For other substrates (3L-Pf3 with extended hydrophobic region), spontaneous insertion occurs at biologically relevant rates

The experimental evidence suggests that the lipid composition and arrangement within liposomes may differ from the cell membrane, affecting insertion efficiency and potentially explaining some in vitro/in vivo discrepancies .

What are the limitations of current methodologies for studying membrane protein insertases?

Current methodologies for studying membrane protein insertases like YidC have several limitations that researchers should acknowledge and address:

  • Reconstitution system limitations:

    • Simplified lipid compositions that may not fully recapitulate native membrane environments

    • Difficulty in establishing physiologically relevant transmembrane potentials

    • Challenges in controlling protein orientation during reconstitution

    • Absence of auxiliary factors present in vivo

  • Substrate selection biases:

    • Over-reliance on model substrates (e.g., Pf3 coat protein) that may not represent all YidC substrates

    • Preference for small, single-spanning membrane proteins that are easier to work with experimentally

    • Limited investigation of complex multi-spanning membrane proteins

  • Analytical challenges:

    • Difficulty in real-time monitoring of insertion events

    • Reliance on endpoint measurements (protease protection) that may miss intermediate states

    • Limited structural information about insertion intermediates

  • Methodological improvements:

    • Develop more complex reconstituted systems with multiple components

    • Implement advanced biophysical techniques for real-time monitoring

    • Combine biochemical and structural approaches to elucidate insertion mechanisms

    • Utilize genetic approaches (suppressor mutations, directed evolution) to identify functional interactions

Despite these limitations, reconstituted systems have provided valuable insights into YidC function, demonstrating that approximately 150 Pf3 coat protein molecules can be inserted per YidC molecule, confirming its catalytic role in membrane insertion .

What are the most promising research directions for advancing understanding of YidC function?

Future research on YidC function should focus on several promising directions that will advance our fundamental understanding of membrane protein insertion:

  • Structural and mechanistic studies:

    • High-resolution structural determination of YidC during various stages of the insertion process

    • Investigation of substrate binding sites and conformational changes during insertion

    • Elucidation of the catalytic mechanism by which YidC facilitates membrane insertion

  • Systems biology approaches:

    • Comprehensive identification of the full substrate spectrum of YidC across different organisms

    • Investigation of the interplay between YidC-dependent and Sec-dependent insertion pathways

    • Exploration of potential regulatory mechanisms controlling YidC activity in response to cellular conditions

  • Evolutionary perspectives:

    • Detailed comparative analysis of YidC homologs across bacterial species and its evolutionary relatives (Oxa1p, Alb3) in eukaryotic organelles

    • Investigation of functional conservation and specialization across different biological systems

  • Technological advancements:

    • Development of high-throughput assays for measuring insertion efficiency

    • Creation of more sophisticated reconstituted systems incorporating multiple components

    • Application of single-molecule techniques to study insertion events in real-time

The catalytic nature of YidC, demonstrated by its ability to insert approximately 150 Pf3 coat protein molecules per YidC molecule, suggests that understanding its precise mechanism could provide insights applicable to membrane protein insertion more broadly .

What research approaches could improve serological detection of Mycoplasma genitalium infections?

Advancing serological detection of M. genitalium infections requires innovative research approaches addressing current limitations:

  • Antigen discovery and validation:

    • Comprehensive proteomic screening to identify additional M. genitalium-specific antigens

    • Epitope mapping of candidate antigens to identify species-specific regions

    • Structure-guided design of recombinant antigens with enhanced specificity

  • Advanced immunological approaches:

    • Development of monoclonal antibodies targeting M. genitalium-specific epitopes

    • Multiplex assays simultaneously detecting antibodies against multiple antigens

    • Avidity testing to distinguish recent from past infections

  • Clinical validation strategies:

    • Longitudinal studies correlating serological responses with infection outcomes

    • Investigation of antibody dynamics following treatment

    • Establishment of serological markers associated with reproductive complications

  • Implementation science:

    • Development of point-of-care testing platforms for resource-limited settings

    • Validation of testing algorithms for different clinical scenarios

    • Cost-effectiveness analyses to guide clinical implementation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.