Recombinant Mycoplasma genitalium Oligopeptide transport system permease protein oppB (oppB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
oppB; MG077; Oligopeptide transport system permease protein OppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
oppB
Target Protein Sequence
MFKYILKRLGLAVVAMFIVMSIVFFLVNATGNVPLSATSARDIAAVQAQLQEFGFNDPII VRYFRYWAKLFSFQADALGIYYANPNQTIGEIVFARVPNTLYVVLISFLIGSLLGIFLGM VSGLNRGKFLDAAINVLVVLFVSIPSFVVGLGLLKLAGFLNLPPRFINFDDAFFSFDRFL LASIIPILSLVFYSSAAFTYRIRNEVVEVMNQDYIKTAKSKGLGMFAVARYHIFRNSIIP SIPLFVFGISGAFSGGFIIESLFGVQGVSRILIDSVQVNETNMVMFNILFIQGIPLLASV FIEFIYVLVDPRIRIANSSNVSLLTKLKFLSSRHQWLMKWNKINSDNAQNIVFNSPLHHQ LLELNAIDYKTKTVQLTTEQKTALNISATANFILLGNKCLKLKTIHG
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for oligopeptides. It is likely responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Mycoplasma genitalium Oligopeptide transport system permease protein oppB and what is its basic function?

Mycoplasma genitalium oppB is a 407-amino acid membrane protein component of the oligopeptide transport system in this sexually transmitted pathogen. The protein functions as a permease within a multi-protein complex responsible for transporting small peptides across the bacterial cell membrane . This transport system is critical for bacterial nutrition and survival as M. genitalium has limited biosynthetic capabilities as a facultative anaerobic organism with a minimal genome . The protein contains multiple transmembrane domains that form a channel structure, allowing for the regulated passage of oligopeptides into the bacterial cell.

As a permease protein, oppB specifically helps create the transmembrane channel through which oligopeptides pass. The full-length protein (amino acids 1-407) includes several hydrophobic regions that anchor it within the bacterial membrane, as evident in its amino acid sequence which contains multiple stretches of hydrophobic residues typical of transmembrane domains .

How can recombinant M. genitalium oppB protein be effectively expressed in laboratory settings?

Recombinant M. genitalium oppB can be effectively expressed using E. coli expression systems with appropriate tags for purification. The methodology involves:

  • Gene synthesis or cloning of the oppB coding sequence (1-407 amino acids) into an appropriate expression vector

  • Addition of an affinity tag (commonly His-tag) for purification purposes

  • Transformation into a suitable E. coli strain optimized for membrane protein expression

  • Induction of protein expression under controlled conditions

  • Cell lysis and membrane fraction isolation

  • Affinity purification using the attached tag system

For optimal results, researchers should use an E. coli strain designed for toxic or membrane protein expression, as demonstrated in available recombinant products where the full-length M. genitalium oppB (1-407aa) is fused to an N-terminal His tag . Expression verification should include SDS-PAGE analysis to confirm protein purity (>90% purity is achievable) .

What storage and handling considerations are critical for maintaining recombinant oppB protein stability?

Maintaining the stability of recombinant M. genitalium oppB protein requires specific storage and handling protocols:

ParameterRecommended ConditionRationale
Storage Temperature-20°C to -80°C for long-termPrevents protein degradation and maintains structural integrity
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0Stabilizes protein conformation during freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper solubilization without aggregation
AliquotingSmall working volumes with 5-50% glycerolPrevents repeated freeze-thaw damage
Freeze-thaw cyclesMinimize; store working aliquots at 4°C for up to one weekPrevents protein denaturation and activity loss

Researchers should centrifuge vials briefly before opening to bring contents to the bottom and reconstitute the lyophilized protein according to recommended concentrations. Adding glycerol (typically to a final concentration of 50%) before aliquoting helps maintain protein stability during storage at -20°C/-80°C .

What controls should be implemented when studying oppB interactions with host cells?

When investigating oppB interactions with host epithelial cells, researchers should implement multiple experimental controls:

  • Negative controls:

    • Untreated host cells without protein exposure

    • Heat-denatured oppB protein (to verify specific activity)

    • Non-related bacterial protein of similar size and tag

    • Competitive binding inhibition with excess unlabeled protein

  • Positive controls:

    • Known M. genitalium adhesin proteins with established binding properties

    • Validated cell surface receptor interactions

  • Expression verification controls:

    • Western blot confirmation of His-tagged oppB using anti-His antibodies

    • Mass spectrometry validation of purified protein

    • Functional activity assays for oligopeptide transport capability

Given M. genitalium's ability to attach to epithelial cells with its specialized tip structure , researchers should carefully distinguish between oppB-specific interactions and those mediated by other M. genitalium components by using appropriately designed recombinant constructs and mutant bacterial strains.

How should researchers approach contradictory data when studying oppB function?

When encountering contradictory data in oppB functional studies, researchers should implement a systematic troubleshooting approach:

  • Thoroughly examine the data to identify specific discrepancies and patterns that contradict the initial hypothesis

  • Pay special attention to outliers that may have influenced results, conducting comprehensive analysis to gain insights into the complexities of contradictory findings

  • Compare expected versus actual results by pinpointing inconsistencies or deviations in experimental outcomes

  • Evaluate alternative hypotheses that could explain unexpected results, such as:

    • Post-translational modifications affecting protein function

    • Unexpected co-factor requirements

    • Buffer composition effects on protein conformation

    • Host cell type-specific interactions

  • Refine experimental variables by implementing additional controls and methodological adjustments to resolve contradictions

  • Consider biological relevance in the context of M. genitalium's pathophysiology and host-pathogen interactions

Researchers should approach contradictory data with an open mind, as unexpected findings can lead to new discoveries and research directions. This approach aligns with established scientific methodology for handling data that contradicts initial hypotheses .

How might oppB contribute to M. genitalium's pathogenicity and association with reproductive tract diseases?

The oligopeptide transport system permease protein oppB may contribute to M. genitalium's pathogenicity through several potential mechanisms:

  • Nutrient acquisition: By facilitating oligopeptide uptake, oppB likely supports bacterial survival in nutrient-limited environments of the reproductive tract

  • Host-pathogen interactions: Membrane permeases may serve dual functions as both transporters and adhesins, potentially contributing to M. genitalium's ability to attach to epithelial cells

  • Inflammatory response modulation: Bacterial membrane proteins can trigger pattern recognition receptors, potentially contributing to the inflammatory pathologies associated with M. genitalium infection including cervicitis, endometritis, and pelvic inflammatory disease

  • Persistence mechanisms: Nutrient transport systems are critical for long-term bacterial survival and may contribute to M. genitalium's persistence in reproductive tissues leading to chronic inflammation

The connection between oppB function and pathogenesis requires experimental validation, as M. genitalium has clearly established associations with multiple reproductive tract pathologies including cervicitis, endometritis, pelvic inflammatory disease, infertility, and adverse birth outcomes . Research into oppB's role should consider M. genitalium's unique invasive capabilities, as it can attach to and invade epithelial cells with its specialized tip structure .

What advanced methodologies are recommended for studying oppB interactions with the host immune system?

Investigating oppB interactions with host immune components requires sophisticated methodological approaches:

  • Cell-based interaction studies:

    • Flow cytometry to quantify binding to immune cells

    • Confocal microscopy with fluorescently-labeled oppB to visualize cellular interactions

    • ELISA-based binding assays with immobilized host immune components

  • Immunological response assessment:

    • Cytokine profiling (Luminex or ELISA) following oppB exposure

    • NF-κB reporter assays to measure inflammatory pathway activation

    • Gene expression analysis via RNA-seq to identify immune response signatures

  • Structural interaction characterization:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Protein-protein interaction mapping via cross-linking mass spectrometry

    • Cryo-electron microscopy to visualize oppB-receptor complexes

  • In vivo relevance:

    • Transgenic mouse models expressing human receptors

    • Ex vivo tissue explant systems to assess oppB interactions in tissue context

    • Comparison of wild-type and oppB-mutant M. genitalium strains in infection models

Since M. genitalium infection has been associated with increased susceptibility to HIV infection through mechanisms involving epithelial layer disruption , researchers should consider experimental designs that assess how oppB may contribute to epithelial barrier function and immune cell recruitment.

How does the ABAB experimental design apply to functional studies of M. genitalium oppB?

The ABAB (reversal) experimental design offers valuable methodological advantages for studying the functional properties of M. genitalium oppB:

This design is particularly valuable for studying oppB's effects on epithelial cell permeability, inflammatory responses, or oligopeptide transport, as it allows researchers to establish causality between oppB exposure and observed effects. The reversal phase provides critical information about the persistence of oppB-induced changes and potential compensatory mechanisms .

How might oppB research contribute to understanding M. genitalium's role in HIV susceptibility?

Research into M. genitalium oppB may provide valuable insights into mechanisms underlying the established association between M. genitalium infection and increased HIV susceptibility:

  • Epithelial barrier disruption:

    • If oppB contributes to M. genitalium's ability to compromise epithelial integrity, it may be directly involved in creating pathways for HIV transmission

    • Experimental models could assess whether purified oppB affects tight junction proteins and epithelial barrier function

  • Inflammatory microenvironment:

    • M. genitalium infection activates HIV target cells beyond the epithelial layer

    • Studies should investigate whether oppB triggers pro-inflammatory cascades that recruit HIV-susceptible immune cells

  • Temporal relationship analysis:

    • Research designs should consider the demonstrated temporal relationship between M. genitalium infection and HIV acquisition (aOR = 7.19; 95% CI 1.68 to 30.77)

    • Longitudinal studies examining oppB-specific immune responses could clarify mechanisms

  • Experimental approaches:

    • Trans-well co-culture systems with epithelial and immune cells

    • HIV pseudovirus transmission assays in the presence of purified oppB

    • Comparative studies using wild-type and oppB-mutant M. genitalium strains

The research is particularly significant given evidence that M. genitalium increases HIV infection risk by reducing epithelial integrity and activating HIV target cells beyond the epithelial layer . Understanding oppB's potential contribution to these processes could inform novel prevention strategies.

What are the key considerations for developing oppB-targeted diagnostic or therapeutic approaches?

Development of oppB-targeted diagnostics or therapeutics should address several critical considerations:

  • Diagnostic applications:

    • Specificity assessment: Evaluate cross-reactivity with related proteins from other Mycoplasma species

    • Accessibility analysis: Determine if oppB is surface-exposed and detectable in clinical samples

    • Antibody development: Generate and validate high-affinity antibodies against unique oppB epitopes

    • Expression level assessment: Confirm consistent oppB expression across clinical isolates

  • Therapeutic targeting:

    • Functional significance: Validate oppB's essentiality for M. genitalium survival or virulence

    • Inhibitor development: Screen for small molecules that block oppB transport function

    • Peptide mimetics: Design competitive inhibitors based on natural oligopeptide substrates

    • Accessibility assessment: Determine if oppB is accessible to therapeutic agents in vivo

  • Clinical implementation considerations:

    • Impact on commensal flora: Assess potential cross-reactivity with beneficial microbes

    • Resistance development: Evaluate genetic barriers to resistance for oppB-targeting therapeutics

    • Bioavailability: Design delivery systems appropriate for reproductive tract infections

    • Clinical validation: Establish correlation between oppB inhibition and infection clearance

Given that M. genitalium has been associated with cervicitis, endometritis, pelvic inflammatory disease, infertility, HIV susceptibility, and adverse birth outcomes , developing oppB-targeted approaches could address significant public health challenges, especially as recent guidelines for first-line PID treatment do not adequately cover M. genitalium infections .

What are the optimal protocols for assessing recombinant oppB protein quality and functionality?

Comprehensive quality assessment of recombinant M. genitalium oppB requires multiple analytical approaches:

Assessment ParameterRecommended MethodAcceptance Criteria
Purity verificationSDS-PAGE with Coomassie staining≥90% purity
Identity confirmationWestern blot with anti-His antibodySingle band at expected molecular weight
Mass validationMass spectrometry (MALDI-TOF)Match to theoretical mass
Secondary structureCircular dichroism spectroscopyAlpha-helical content consistent with membrane protein
Oligomeric stateSize exclusion chromatographyExpected oligomeric distribution
Membrane integrationLiposome reconstitution assaySuccessful incorporation into lipid bilayer
Functional activityFluorescent peptide transport assayConcentration-dependent transport activity

For functional validation, researchers should:

  • Reconstitute purified oppB in proteoliposomes containing appropriate lipids

  • Load fluorescent oligopeptide substrates inside vesicles

  • Measure fluorescence changes upon substrate transport

  • Compare transport rates between active protein and denatured controls

Researchers should note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . Protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with glycerol addition recommended for long-term storage .

How can researchers effectively design mutations to study structure-function relationships in oppB?

Strategic mutation design is essential for elucidating oppB structure-function relationships:

  • Transmembrane domain mutations:

    • Identify predicted transmembrane regions using hydrophobicity analysis

    • Introduce conservative substitutions (e.g., Leu→Ile) to maintain structure but alter specific interactions

    • Create charge introduction mutations (e.g., Ala→Lys) to disrupt membrane spanning

  • Substrate binding pocket mutations:

    • Identify conserved residues across oligopeptide transporters

    • Target polar and charged residues likely involved in peptide recognition

    • Create binding pocket size alterations through bulky or small side chain substitutions

  • Conformational switch regions:

    • Target glycine residues in potential hinge regions

    • Modify proline residues that may contribute to structural transitions

    • Alter potential salt bridge interactions that stabilize specific conformations

  • Systematic mutation approaches:

    • Alanine-scanning mutagenesis of key domains

    • Cysteine substitutions for accessibility studies and cross-linking

    • Domain swapping with homologous transporters from non-pathogenic species

Each mutant should be characterized for expression, stability, membrane localization, and transport function using the quality assessment protocols outlined in section 5.1. Correlating structural changes with functional outcomes will provide insights into oppB's mechanism of action and potential targeting strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.