Recombinant Mycoplasma genitalium P32 adhesin (MG318)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MG318; P32 adhesin; Cytadhesin P32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG318
Target Protein Sequence
MELNGFLRYKKLFIVLALLFTTILIVSLSLLAFALVVKTNGSELGVVFHQTEDNTTVIQG RSIVEQPWFIPTVAGSFGFSALAIILGLAIGLPIVKRKEKRLLEEKERQEQIAEQLQRIS DQQEQQTVEIDPQQSQAQPSQPQVQQPLQPQFQQRVPLLRPAFNPNMQQRPGFNQPNQQF QPHNNFNPRMNPNMQRPGFNPNMQQRPGFNQPNQQFQPHNNFNPRMNPNMQRPGFNQPHP NQFAQPNNFNPNMQQRPGFNPNMQQRPNPSQLMPKGGLKP
Uniprot No.

Target Background

Function
An adhesin crucial for successful cytadherence and pathogenicity.
Database Links
Subcellular Location
Cell projection, attachment organelle membrane; Multi-pass membrane protein.

Q&A

What is P32 adhesin (MG318) and what is its role in Mycoplasma genitalium?

P32 adhesin, encoded by the mg318 gene, is a membrane-associated surface-exposed adhesin located at the distal end of the attachment organelle in Mycoplasma genitalium. This protein plays a significant role in the adhesion process, contributing to bacterial virulence and pathogenicity. P32 is analogous to the P30 adhesin found in M. pneumoniae, although there are structural differences between the two proteins . As part of the terminal organelle structure, P32 participates in the complex adhesion mechanism that allows M. genitalium to attach to host cells and surfaces, a crucial step in establishing infection .

What is the molecular structure of P32 adhesin?

P32 adhesin possesses novel proline-rich repeats at its C-terminus, though these repeats are less regular than those found in its M. pneumoniae analog, P30 . The full-length protein consists of 280 amino acids (residues 1-280) with a molecular weight of approximately 32 kDa, hence its designation as P32 . The amino acid sequence reveals a protein that contains hydrophobic regions consistent with membrane association and surface exposure. When expressed recombinantly, such as with an N-terminal His-tag, the protein maintains its structural integrity, allowing for experimental studies of its functional properties .

How does P32 adhesin interact with other proteins in the terminal organelle?

P32 adhesin contributes to the stability of the major adhesins P140 and P110. Research has demonstrated that transfection of an additional copy of the mg318 gene into both MG218 and MG491 null mutant strains significantly restored P140 and P110 levels . This finding suggests that P32 plays a stabilizing role for these major adhesin proteins. The terminal organelle is a polar structure protruding from the cell body that is internally supported by a cytoskeleton and has an important role in cell motility . Within this complex structure, P32 works in concert with other proteins to maintain the functional integrity of the adhesion apparatus .

What are the implications of P32 mutations for understanding Mycoplasma genitalium pathogenicity?

Based on comparative studies with M. pneumoniae, where P30 adhesin-deficient mutants show a noncytadhering, avirulent phenotype and abnormal tip structures, researchers postulate that M. genitalium P32 performs a similar function . Mutations in P32 likely compromise the bacteria's ability to adhere to host tissues, potentially reducing colonization and subsequent pathogenicity. The study of P32 mutants provides insights into the minimal requirements for bacterial motility and adhesion, which are crucial virulence factors . Understanding these mechanisms could lead to novel therapeutic approaches targeting mycoplasma infections by disrupting adhesion processes .

What are the optimal conditions for recombinant P32 adhesin expression and purification?

For optimal recombinant expression of P32 adhesin, researchers typically use E. coli as an expression system with an N-terminal His-tag for purification purposes . The full-length protein (amino acids 1-280) can be expressed and subsequently purified using standard affinity chromatography techniques. After purification, the protein is often stored as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add 5-50% glycerol (with 50% being a common final concentration) and store aliquots at -20°C to -80°C to prevent protein degradation . Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

How can researchers effectively study P32 adhesin's role in cell adhesion mechanisms?

To study P32's role in cell adhesion, researchers can employ several complementary approaches:

  • Genetic manipulation: Creating null mutants for MG318 or introducing additional copies of the gene, as demonstrated in previous studies with MG218 and MG491 null mutants .

  • Microscopy techniques: Utilizing microcinematography, epifluorescence microscopy, and cryo-electron microscopy to visualize cell motility and adhesion structures .

  • Adhesion assays: Developing in vitro assays using host cell cultures or mucin-coated surfaces to quantify adhesion capabilities of wild-type versus mutant strains .

  • Protein-protein interaction studies: Investigating interactions between P32 and other adhesins (P140, P110) or cytoskeletal components using co-immunoprecipitation or crosslinking studies .

These methodological approaches provide comprehensive insights into P32's functional role in adhesion mechanisms and its interactions with other cellular components.

What experimental models are most appropriate for studying P32 adhesin function in the context of pathogenicity?

Several experimental models can be employed to study P32 adhesin function in pathogenicity:

  • Cellular models: Human epithelial cell lines (particularly from urogenital tissues) provide relevant models for adhesion studies since they represent natural host cells for M. genitalium .

  • Minimized motile machinery models: The engineered strains containing extra copies of MG318 in MG491 or MG218 null backgrounds represent valuable cell models to investigate adhesion and gliding properties in a simplified system .

  • Mucosal surface models: In vitro systems using mucin-coated surfaces can mimic the natural environment where M. genitalium adheres during infection. This is particularly relevant given the discovery that GAPDH acts as a mucin-binding protein in concert with other adhesins .

  • Comparative studies: Parallel investigations of P32 in M. genitalium and P30 in M. pneumoniae can provide insights through evolutionary and functional comparisons .

Each model offers distinct advantages for understanding different aspects of P32's role in pathogenicity and can be selected based on specific research questions.

How should researchers interpret contradicting data regarding P32 adhesin function across different experimental systems?

When encountering contradictory data regarding P32 function across experimental systems, researchers should consider:

  • Methodological differences: Variations in expression systems (E. coli vs. native), protein tagging methods, and purification protocols can affect protein functionality .

  • Context-dependent functions: P32 may exhibit different behaviors depending on the presence or absence of other terminal organelle components. This is exemplified by the observation that P32 overexpression can partially compensate for the lack of cytoskeletal proteins in certain mutants .

  • Strain variations: Different laboratory strains or clinical isolates of M. genitalium may show variations in P32 structure or function due to genomic differences.

  • Experimental conditions: Adhesion studies conducted under different pH, temperature, or ionic strength conditions may yield different results.

A systematic approach to reconciling contradictory data involves standardizing experimental conditions where possible, employing multiple complementary techniques to address the same question, and carefully considering the biological context of each experimental system.

What bioinformatic tools and databases are most useful for analyzing P32 adhesin structure and function?

For comprehensive analysis of P32 adhesin, researchers should utilize:

Bioinformatic Tool/DatabaseApplication for P32 ResearchKey Features
UniProt (Q49417)Primary sequence information and annotationsProvides curated protein information, post-translational modifications, domain structure
Protein Data Bank (PDB)Structural information (if available)3D protein structures and related visualization tools
BLAST/HMMERSequence similarity searchesIdentification of homologs and conserved domains across bacterial species
PSIPRED/JPredSecondary structure predictionPrediction of alpha-helices, beta-sheets, and other structural elements
TMHMM/TOPCONSTransmembrane domain predictionIdentification of membrane-spanning regions relevant to P32's membrane association
ConSurfEvolutionary conservation analysisMapping conserved regions that may be functionally important
STRINGProtein-protein interaction networksVisualization of known/predicted interactions with other M. genitalium proteins

These tools collectively provide a comprehensive framework for analyzing the structural features of P32 that underlie its adhesion functions and interactions with other proteins.

What are the most promising approaches for targeting P32 adhesin in antimicrobial development?

Given P32's critical role in M. genitalium adhesion and pathogenicity, several approaches for antimicrobial development appear promising:

  • Adhesin-blocking peptides or antibodies: Developing molecules that specifically bind to P32 and prevent its interaction with host cell receptors could inhibit bacterial attachment .

  • Small molecule inhibitors: Identifying compounds that disrupt the interaction between P32 and other terminal organelle components (P140/P110) could destabilize the adhesion machinery .

  • Gene expression modulators: Molecules that downregulate mg318 expression could potentially reduce bacterial virulence without directly killing bacteria, potentially reducing selection pressure for resistance .

  • Structure-based drug design: As more detailed structural information becomes available, rational design of inhibitors targeting specific functional domains of P32 could provide highly specific antimicrobials .

These approaches offer potential alternatives to conventional antibiotics, addressing the growing concern of antimicrobial resistance in M. genitalium infections.

How might understanding P32 adhesin contribute to developing more effective diagnostic tools for M. genitalium infections?

Enhanced understanding of P32 adhesin could improve diagnostic capabilities through:

  • Specific antibody development: Antibodies targeting unique epitopes of P32 could be incorporated into immunoassays for detecting M. genitalium with high specificity .

  • Recombinant antigen-based tests: Purified recombinant P32 could serve as a standard antigen for serological tests detecting anti-M. genitalium antibodies in patient samples .

  • PCR target optimization: Identifying conserved regions of the mg318 gene across clinical isolates could improve nucleic acid amplification tests for M. genitalium detection .

  • Point-of-care testing: Knowledge of P32's immunogenic properties could facilitate development of rapid diagnostic tests suitable for resource-limited settings.

The immunogenicity of P32 makes it particularly valuable for diagnostic applications, potentially allowing for earlier and more accurate detection of M. genitalium infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.