Recombinant Mycoplasma genitalium Probable ABC transporter permease protein MG189 (MG189)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mycoplasma Metabolism

MG189 operates within a phosphonate ABC transporter complex alongside MG290 (permease) and MG291 (integral membrane protein) . This system facilitates substrate translocation across membranes, critical for nutrient uptake in M. genitalium’s minimal genome . Key findings:

  • Ligand Specificity: Binds thiamine (vitamin B1) and phosphonates, enabling metabolic flexibility .

  • Dimerization: Forms homodimers in a concentration-dependent manner, as shown by SAXS and SEC .

  • Essentiality: Non-lethal gene disruption suggests redundancy with other transporters, yet retains classification as essential for survival .

Genomic Neighborhood:

  • Operon Structure: MG189 resides in a three-gene operon (MG289-MG291) encoding substrate-binding, permease, and membrane proteins .

  • Homologs: M. pneumoniae MPN_136 shares 67% sequence identity, suggesting conserved transporter roles across mycoplasma species .

Challenges and Future Directions

  • Crystallization Difficulties: Membrane localization complicates structural studies, though SAXS and homology modeling partially address this .

  • Antimicrobial Targeting: MG189’s ATPase domain is a candidate for novel inhibitors to disrupt M. genitalium’s nutrient import .

  • Synthetic Biology Applications: Used in minimal genome projects to define essential transport systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your product.
Synonyms
MG189; Probable ABC transporter permease protein MG189
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG189
Target Protein Sequence
MFKNNLRFTSWINQHKFYQLDLSLKTRSIKQIVLTLVFKTLVLGFFGLIVIFPFYLMVVV SFASDERALDTRTPILWPDSWNFDNFSRVLSDGKYLNAIVVNTLVTVLSVLLTLFFTICM GYSFSLRKWKYKKLVWFFFLSVLILPESALLIGQYRIVIVANWNNPNSPLIVLGLIMPFV SSVFSGFMYRTSFEAIPSQLKESALIDGCNGFNYFLKIALPMVKSTSWTVGILTAFSAWN SYLWPLLLLGNRVDLNINLWVLQQGILDANSSDEQIRTLLNLKMSAAILAILPMFIIYFL FHKRIMNAIKNRANTIKG
Uniprot No.

Target Background

Function
This protein is likely part of a binding-protein-dependent transport system. It is probably responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MG189 and what is its role in Mycoplasma genitalium?

MG189 is a probable ABC transporter permease protein encoded by the MG189 gene in Mycoplasma genitalium, a sexually transmitted bacterial pathogen. As a component of an ABC transporter system, MG189 likely functions as a transmembrane protein that forms a channel for substrate transport across the cell membrane. The protein consists of 318 amino acids and functions as part of the diverse ABC transporter family, one of the largest families of membrane proteins in most organisms . ABC transporters typically consist of two nucleotide-binding domains and two transmembrane domains, with MG189 serving as one of the transmembrane components. In the context of M. genitalium biology, this protein may be involved in essential physiological processes like nutrient uptake or export of harmful substances, contributing to the bacterium's survival and pathogenicity .

How is recombinant MG189 typically expressed and purified for research purposes?

Recombinant MG189 is typically expressed in Escherichia coli expression systems, with the full-length protein (amino acids 1-318) fused to an N-terminal His-tag to facilitate purification . The expression construct utilizes the MG189 gene sequence from Mycoplasma genitalium, and the protein is expressed in E. coli under optimized conditions to ensure proper folding and stability of this membrane protein. Following expression, the protein is commonly purified using affinity chromatography techniques that exploit the His-tag, such as immobilized metal affinity chromatography (IMAC). After purification, the protein is typically provided in a lyophilized form, which requires reconstitution in a suitable buffer before use . For optimal stability, the recombinant protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0, and aliquoted to avoid repeated freeze-thaw cycles that could compromise protein integrity .

What are the main challenges in working with recombinant MG189 protein?

Working with recombinant MG189 presents several notable challenges inherent to both membrane proteins and proteins derived from fastidious organisms like Mycoplasma genitalium. The hydrophobic nature of this transmembrane protein makes it difficult to maintain proper folding and solubility during expression and purification processes. Researchers often encounter issues with protein aggregation, misfolding, and inclusion body formation when expressing MG189 in heterologous systems like E. coli . The protein's structural integrity is highly sensitive to environmental conditions, requiring careful optimization of buffer compositions, detergent selection, and stabilizing agents to preserve native conformation and functionality. Additionally, M. genitalium's status as a fastidious bacteria means its proteins may have specific requirements for proper expression that differ from standard laboratory organisms . Codon optimization may be necessary when expressing in E. coli due to potential differences in codon usage between the two organisms, and special attention must be paid to purification protocols to minimize protein degradation while maximizing yield and purity .

What techniques are recommended for analyzing the structure of MG189?

For structural analysis of MG189, researchers should consider implementing a multi-technique approach that addresses the challenges inherent to membrane proteins. X-ray crystallography, while challenging with membrane proteins, can provide high-resolution structural information when successful, requiring careful optimization of crystallization conditions using detergents or lipidic cubic phase methods. Cryo-electron microscopy (cryo-EM) offers advantages for membrane proteins like MG189 without the need for crystallization, allowing visualization in a more native-like environment. Nuclear Magnetic Resonance (NMR) spectroscopy can provide information on protein dynamics and ligand binding, particularly useful for smaller domains of the protein. Electron Paramagnetic Resonance (EPR) spectroscopy combined with site-directed spin labeling is particularly valuable for studying conformational changes in ABC transporters, as highlighted in studies with similar proteins . This approach involves introducing spin labels at specific cysteine residues and measuring distances between labeled sites in different conformational states. Homology modeling and molecular dynamics (MD) simulations can complement experimental approaches by providing insights into structural dynamics and conformational changes during the transport cycle, especially useful when building on structures of related ABC transporters .

How can researchers investigate the functional properties of MG189?

To investigate the functional properties of recombinant MG189, researchers should implement a comprehensive approach combining biochemical assays, biophysical techniques, and cellular studies. ATPase activity assays are fundamental for ABC transporters, measuring ATP hydrolysis rates under various conditions to assess how nucleotide binding and hydrolysis couple to conformational changes and transport function. Transport assays using reconstituted proteoliposomes represent a gold standard for functional studies, where MG189 is incorporated into artificial lipid vesicles and substrate transport is measured across the membrane barrier. Substrate binding studies using techniques like isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or fluorescence-based assays can identify potential transported substrates and determine binding affinities. Site-directed mutagenesis of conserved residues, particularly those in the transmembrane regions or substrate-binding pocket, can provide insights into structure-function relationships by identifying amino acids critical for transport activity . Conformational dynamics can be explored using cysteine-reactive fluorescent reagents to track conformational changes during the catalytic cycle, as has been done with other ABC transporters like MsbA . Additionally, complementation studies in bacterial strains lacking endogenous transporters can validate the function of MG189 in a cellular context.

What advanced techniques can be used to study protein-protein interactions involving MG189?

Understanding the protein-protein interactions of MG189 requires sophisticated techniques capable of detecting and characterizing both stable complexes and transient interactions. Cross-linking mass spectrometry (XL-MS) represents a powerful approach for mapping interaction interfaces by chemically cross-linking proteins in close proximity and identifying the linked peptides through mass spectrometry analysis. This technique can reveal contacts between MG189 and other ABC transporter components or regulatory proteins. Co-immunoprecipitation (Co-IP) followed by mass spectrometry can identify natural binding partners of MG189 in a more native context, particularly when performed using antibodies against the endogenous protein in Mycoplasma genitalium lysates. Förster Resonance Energy Transfer (FRET) or Bioluminescence Resonance Energy Transfer (BRET) can detect protein interactions in real-time, even in living cells, by labeling MG189 and potential interaction partners with compatible fluorophores or luciferase/fluorophore pairs . Surface Plasmon Resonance (SPR) and Bio-Layer Interferometry (BLI) provide quantitative binding kinetics and affinity measurements for purified components, helping establish the thermodynamic and kinetic parameters of interactions. X-ray radiolytic footprinting combined with mass spectrometry (XF-MS), though not yet widely applied to ABC transporters, offers valuable insights into protein complex formation by identifying protected regions upon complex assembly .

What expression systems are most effective for producing functional recombinant MG189?

The selection of an appropriate expression system is critical for producing functional recombinant MG189 protein, with several options offering distinct advantages depending on research objectives. E. coli expression systems remain the most widely used platform due to their rapid growth, high protein yields, and cost-effectiveness, with strains like BL21(DE3) or modified strains with reduced genomic complexity, such as E. coli MDS40, showing promise for membrane protein expression . When using E. coli, expression vectors containing strong, inducible promoters like T7 or tac, along with fusion tags such as the His-tag for purification, have proven effective for MG189 expression . For complex membrane proteins requiring extensive post-translational modifications, eukaryotic expression systems such as yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (Sf9 or Hi5 using baculovirus), or mammalian cells may provide a more native-like environment for proper folding and function. Cell-free protein synthesis systems represent an emerging alternative that circumvents toxicity issues often encountered when expressing membrane proteins in living cells, allowing direct incorporation into nanodiscs or liposomes. Regardless of the chosen system, optimization of temperature, inducer concentration, and expression duration is essential, with lower temperatures (16-25°C) often favoring proper folding of membrane proteins like MG189 over maximum yield .

What are the optimal conditions for purifying and storing MG189 to maintain its stability and activity?

Purification and storage of MG189 requires careful consideration of multiple factors to preserve protein integrity and functionality. Initial extraction from cell membranes should utilize mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin, which effectively solubilize membrane proteins while preserving native structure. Affinity chromatography using the N-terminal His-tag represents the primary purification step, optimally performed at 4°C to minimize degradation, with imidazole gradients carefully calibrated to reduce non-specific binding while maximizing target protein recovery . Size exclusion chromatography serves as an essential secondary purification step to separate protein aggregates, multimers, and monomers, additionally providing insights into the oligomeric state of the purified protein. For long-term storage, the protein should be maintained in a stabilizing buffer containing Tris/PBS with 6% trehalose at pH 8.0, as this combination has been shown to protect protein structure during freeze-thaw cycles . Lyophilization represents another viable storage approach, requiring subsequent reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, ideally with 5-50% glycerol added as a cryoprotectant before aliquoting and storing at -20°C or -80°C . Critical quality control assessments should include SDS-PAGE analysis to confirm purity (>90% is typically considered acceptable), circular dichroism to verify secondary structure integrity, and functional assays appropriate to ABC transporters to confirm that the purified protein retains its native activity .

How can researchers effectively reconstitute MG189 into artificial membrane systems for functional studies?

Reconstitution of MG189 into artificial membrane systems represents a crucial step for conducting meaningful functional studies of this ABC transporter permease protein. The most widely employed approach involves proteoliposome formation, where purified MG189 is incorporated into liposomes composed of defined lipid mixtures that mimic the native Mycoplasma genitalium membrane environment. This process typically begins with detergent-solubilized MG189 being mixed with lipids also solubilized in detergent, followed by controlled detergent removal via dialysis, adsorption to Bio-Beads, or dilution below the detergent's critical micelle concentration. The lipid composition should be carefully optimized, testing various mixtures of phosphatidylcholine, phosphatidylethanolamine, phosphatidylglycerol, and cholesterol to identify conditions that best support MG189 activity. For enhanced stability and more controlled insertion, nanodiscs represent an excellent alternative, consisting of disc-shaped lipid bilayers stabilized by membrane scaffold proteins, providing a native-like environment while maintaining sample homogeneity and accessibility to both sides of the membrane. Reconstitution efficiency should be assessed through protein-to-lipid ratio quantification, freeze-fracture electron microscopy to visualize protein distribution, and functional assays such as substrate transport or ATPase activity measurements to confirm that the reconstituted protein retains its native functionality. For advanced biophysical studies, supported lipid bilayers or droplet interface bilayers may provide additional experimental capabilities, allowing integration with surface-sensitive techniques or electrophysiological measurements.

What are the current hypotheses regarding the substrate specificity of MG189?

The substrate specificity of MG189 remains an active area of investigation, with several hypotheses emerging from comparative genomics, structural predictions, and the biological context of Mycoplasma genitalium. As a fastidious organism with a minimal genome, M. genitalium likely relies on transporters like MG189 to acquire essential nutrients from its host environment, suggesting the protein may be involved in importing amino acids, nucleotides, or other growth factors the organism cannot synthesize independently. The transmembrane topology of MG189, featuring multiple membrane-spanning segments creating a central translocation pathway, provides a structural framework for substrate recognition and transport. Computational approaches utilizing homology modeling and docking simulations with potential substrates can generate testable hypotheses regarding binding preferences, considering the physicochemical properties of the predicted substrate-binding cavity. Genomic context analysis, examining genes co-regulated with MG189 or located in the same operon, may provide clues to functional relationships and potential substrates. Experimental approaches to define substrate specificity could include transport assays with radiolabeled compounds, binding studies using techniques like isothermal titration calorimetry or surface plasmon resonance, and growth complementation experiments in bacterial strains with defined transporter deficiencies. The limited biosynthetic capacity of M. genitalium due to its reduced genome suggests MG189 may play a crucial role in nutrient acquisition, potentially handling multiple substrates to compensate for the organism's streamlined transporter repertoire.

What role might MG189 play in the pathogenicity of Mycoplasma genitalium?

MG189, as a probable ABC transporter permease protein, may contribute significantly to Mycoplasma genitalium's pathogenicity through several potential mechanisms related to bacterial survival, persistence, and host interaction. As M. genitalium is a fastidious organism with limited biosynthetic capabilities, MG189 likely plays a crucial role in nutrient acquisition from the host environment, potentially importing essential compounds that the bacterium cannot synthesize independently, thereby supporting growth and persistence during infection . The protein may also function in export mechanisms related to virulence, potentially facilitating the secretion of toxins, inflammatory modulators, or other virulence factors that contribute to the tissue damage observed in conditions like urethritis or cervicitis associated with M. genitalium infections. ABC transporters in various pathogens have been implicated in antimicrobial resistance through efflux mechanisms, suggesting MG189 might similarly contribute to the emerging antibiotic resistance observed in M. genitalium clinical isolates, a concerning trend given this organism's classification as a "stealth" pathogen that often remains undetected and untreated . The protein could also function in maintaining membrane homeostasis under stress conditions encountered during infection, such as pH fluctuations or immune response pressures, contributing to the bacterium's ability to establish persistent infections. Targeting MG189 through novel therapeutics might disrupt essential nutrient acquisition pathways or resistance mechanisms, potentially offering new strategies for treating increasingly antibiotic-resistant M. genitalium infections.

What methods can be used to study the regulation of MG189 expression in Mycoplasma genitalium?

Investigating the regulation of MG189 expression in Mycoplasma genitalium requires specialized approaches that address the unique challenges posed by this fastidious organism. Quantitative reverse transcription PCR (RT-qPCR) represents a foundational technique for measuring MG189 mRNA levels under various conditions, requiring careful design of primers specific to the MG189 gene and appropriate reference genes for normalization. RNA sequencing (RNA-seq) provides a more comprehensive view of the transcriptional landscape, allowing researchers to identify co-regulated genes and potential operonic structures containing MG189, while also detecting any antisense transcripts or small RNAs that might regulate MG189 expression. Promoter analysis through reporter gene assays, where the putative MG189 promoter region is fused to reporter genes like luciferase or fluorescent proteins, can help define regulatory elements and transcription factor binding sites. Chromatin immunoprecipitation followed by sequencing (ChIP-seq) using antibodies against RNA polymerase or suspected transcription factors can identify proteins that interact with the MG189 promoter region in vivo. Translational regulation can be assessed through ribosome profiling, which provides a genome-wide snapshot of actively translating ribosomes, or through the use of translational fusions that link the MG189 5' untranslated region to reporter genes. For studying environmental regulation, researchers can expose M. genitalium cultures to various stimuli thought to be encountered during infection, such as pH changes, nutrient limitation, or host factors, and measure corresponding changes in MG189 expression using the techniques described above.

How does the "fastidious" nature of Mycoplasma genitalium impact experimental approaches to studying MG189?

The fastidious nature of Mycoplasma genitalium significantly impacts experimental approaches to studying MG189, necessitating specialized techniques and careful consideration of growth conditions. M. genitalium's slow growth rate, with a doubling time of approximately 12 hours, extends experimental timelines considerably compared to model organisms like E. coli, requiring researchers to plan long-term culturing strategies and implement rigorous contamination controls during extended incubations . The organism's highly specific nutritional requirements demand specialized media formulations enriched with serum or tissue extracts, making standardization of growth conditions challenging and potentially introducing variability in protein expression patterns. Direct genetic manipulation of M. genitalium to study MG189 function is hampered by low transformation efficiencies and limited genetic tools, often necessitating the development of customized protocols or the use of recombinant approaches in heterologous systems like E. coli . The difficulty in obtaining sufficient biomass from M. genitalium cultures for protein studies creates challenges for direct isolation of native MG189, pushing researchers toward recombinant expression strategies despite potential concerns about proper folding and post-translational modifications. When using fluorescence microscopy or immunolocalization techniques to study MG189 distribution, the extremely small cell size of M. genitalium (typically 0.2-0.3 μm) requires super-resolution microscopy approaches to achieve meaningful spatial resolution. These collective challenges have driven innovation in experimental approaches, including the development of reporter systems suitable for slow-growing bacteria, adaptation of single-cell techniques to reduce biomass requirements, and refinement of heterologous expression systems to better mimic the native cellular environment of this specialized pathogen .

What emerging technologies hold promise for advancing our understanding of MG189?

Several cutting-edge technologies are poised to significantly advance our understanding of MG189 structure, function, and biological significance in the coming years. Cryo-electron microscopy (cryo-EM) continues to undergo revolutionary improvements in resolution capabilities, potentially enabling structural determination of MG189 without the need for crystallization, a particular advantage for membrane proteins that often resist crystallization efforts. Single-molecule approaches such as single-molecule FRET (smFRET) and high-speed atomic force microscopy (HS-AFM) offer unprecedented opportunities to observe MG189 conformational dynamics in real-time, providing insights into the transport mechanism and substrate-induced structural changes. Advances in gene editing technologies like CRISPR-Cas systems, increasingly being adapted for minimal genome organisms, may soon enable precise manipulation of MG189 in its native Mycoplasma genitalium context, allowing in vivo functional studies previously considered technically unfeasible. Microfluidic systems combined with advanced imaging technologies could facilitate the study of MG189 in minimal artificial cells or controlled microenvironments that mimic aspects of the host-pathogen interface. Integrative structural biology approaches that combine multiple experimental techniques with computational modeling will likely provide the most comprehensive view of MG189 structure and dynamics, overcoming limitations inherent to any single methodology. Artificial intelligence and machine learning algorithms applied to protein structure prediction, as exemplified by recent advances like AlphaFold, may soon generate highly accurate MG189 structural models that can guide experimental design and interpretation even in the absence of experimental structures.

What are the most promising strategies for addressing challenges in MG189 research?

Addressing the multifaceted challenges in MG189 research requires innovative strategies that span molecular, cellular, and computational approaches. For expression and purification challenges, exploring specialized expression hosts like the multiple-deletion strain E. coli MDS40, which has a 14% smaller genome than its parent strain, may improve recombinant protein yields while maintaining growth characteristics suitable for large-scale production . Membrane mimetic systems beyond traditional liposomes, such as nanodiscs, lipodisqs, or amphipols, offer promising alternatives for stabilizing MG189 in solution while maintaining a native-like environment for functional studies. Developing Mycoplasma-optimized cell-free protein synthesis systems could circumvent many of the challenges associated with in vivo expression, allowing direct incorporation of MG189 into artificial membranes while avoiding toxicity issues. For structural studies, hybrid approaches that integrate low-resolution data from techniques like small-angle X-ray scattering or electron microscopy with computational modeling may prove more successful than pursuing high-resolution crystal structures alone. Establishing collaborative networks that bring together expertise in membrane protein biochemistry, mycoplasma biology, and advanced biophysical techniques will accelerate progress by enabling access to specialized equipment and knowledge. Computational approaches, including molecular dynamics simulations and machine learning-assisted homology modeling, can generate testable hypotheses about MG189 structure and function when experimental data is limited or challenging to obtain. For functional characterization, development of high-throughput screening platforms to identify substrates, inhibitors, or interaction partners could overcome the current limitations of labor-intensive individual assays.

How might research on MG189 contribute to broader understanding of ABC transporters and bacterial pathogenesis?

Research on MG189 has significant potential to advance our fundamental understanding of ABC transporters while simultaneously providing insights into bacterial pathogenesis strategies, particularly for minimal genome pathogens. As a component of an ABC transporter system in an organism with extreme genome reduction, MG189 likely represents an evolutionarily optimized version of a transmembrane domain, potentially revealing the essential structural and functional elements required for ABC transporter operation when stripped of non-essential features. Comparative studies between MG189 and homologous proteins from bacteria with larger genomes could illuminate how these transporters have been adapted across diverse bacterial lifestyles, from free-living to obligate parasitic states. The specialized host-adapted context of MG189 may reveal novel substrate preferences or transport mechanisms tailored to the human urogenital tract environment, potentially identifying new functional capabilities within the broader ABC transporter family . From a pathogenesis perspective, understanding MG189's role in nutrient acquisition or potential contributions to antibiotic resistance could reveal vulnerabilities that could be exploited for therapeutic intervention against M. genitalium, which is increasingly recognized as an important sexually transmitted pathogen with emerging antibiotic resistance. Methodological advances developed to study this challenging protein, such as specialized expression systems or innovative membrane mimetics, may prove applicable to other difficult-to-study membrane proteins across diverse pathogens. The minimal genome context of M. genitalium provides a uniquely simplified system for studying host-pathogen interactions mediated by transporters like MG189, potentially revealing fundamental principles that are obscured in more complex bacterial systems with redundant transport mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.