Recombinant Mycoplasma genitalium Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Function of Prolipoprotein Diacylglyceryl Transferase (Lgt)

Lgt is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis. It transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins . This modification is critical for anchoring lipoproteins to bacterial membranes and is essential for viability in organisms like Escherichia coli .

Key Features of Lgt:

  • Membrane Topology: Lgt is embedded in the inner membrane via seven transmembrane segments, with its N-terminus facing the periplasm and C-terminus facing the cytoplasm .

  • Conserved Motifs: A signature motif (e.g., residues Y26, N146, G154 in E. coli) is essential for enzymatic activity .

  • Role in Pathogenesis: Lipoproteins modified by Lgt often function as virulence factors in pathogenic bacteria .

Lgt in Mycoplasma genitalium

  • M. genitalium lipoproteins (e.g., MgPa adhesion protein) are critical for host cell interaction and pathogenesis .

  • Lipid-associated membrane proteins (LAMPs) in M. genitalium are antigenic targets, but their modification pathway (including potential Lgt involvement) is not detailed .

Recombinant M. genitalium Proteins

While Lgt itself is not described, other recombinant M. genitalium proteins have been studied:

Table 1: Recombinant M. genitalium Proteins in Research

ProteinFunctionApplicationReference
MG075Lipid-associated membrane proteinSerological assay development
MG517GlycosyltransferaseSynthesis of glycoglycerolipids
MgPaAdhesion proteinHost cell interaction studies

Research Gaps and Challenges

  • Lgt Homolog in M. genitalium: The genome of M. genitalium is highly reduced (580 kb), but no explicit annotation or characterization of an Lgt homolog was identified in the provided sources.

  • Technical Limitations: Recombinant expression of hydrophobic M. genitalium proteins (e.g., MG075) often requires denaturing conditions due to inclusion body formation .

Implications for Future Studies

  • Target Identification: If Lgt exists in M. genitalium, its recombinant expression would require codon optimization (e.g., resolving TGA stop codons, which encode tryptophan in mycoplasmas) .

  • Therapeutic Potential: Enzymes like Lgt are potential antibiotic targets due to their essential role in lipoprotein biogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you require a specific format, please indicate your preference in the order notes. We will endeavor to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is preferred, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us. We will prioritize developing the specified tag if feasible.
Synonyms
lgt; MG086; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
lgt
Target Protein Sequence
MNRPSWSTAFNIGGGFPIQWYGIIVSIGIIFAILMFVFKLIYCYKLQDNSFYFFIFIAVL TMVLGARLWSFVIGDSNFANNNFFDFRNGGLAIQGGILLTSIVGVIYFNFFLNSKTNKTK TIAELLNNKNEIKAVYVERNISVLVMLDLIAPCVLIGQAIGRWGNFFNQEVYGFALAGTM NDPQALANTQWGFLKILMPKVWDGMWIDGQFRIPLFLIESFFNTIFFVLIYFVMDFIRGV KSGTIGFSYFLATGIIRLILENFRDQTFYFQTSITTSILFIVVGILGIFYCQFIHVKLRN YFWTYFFLYAFYKVAAFFTTLFLNNRKQMAQQKFAFYEKSLPNKKRSFFEMKYYNDVTTP KIYRLTDQEMKLFDKLEAVTTS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of lgt in Mycoplasma genitalium pathogenesis?

Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the invariant cysteine residue in the lipobox motif of bacterial prolipoproteins. In M. genitalium, this post-translational modification is critical for membrane anchoring of lipoproteins that mediate host-pathogen interactions and contribute to inflammatory responses . M. genitalium infection leads to significant leucocyte infiltration in the genital tract, with studies showing 100% of M. genitalium-positive samples having a leukocyte/epithelial cell ratio >2.0, compared to only 22.9% in negative samples . This inflammatory response is partially attributed to lipoproteins processed by lgt, which act as pathogen-associated molecular patterns (PAMPs) that stimulate host immune responses through Toll-like receptor recognition.

How can recombinant M. genitalium lgt be expressed in laboratory settings?

Recombinant expression of M. genitalium lgt typically employs E. coli-based expression systems due to the challenging nature of culturing M. genitalium itself, which is described as "fastidious" and requires specific conditions to thrive . The recommended methodology involves:

  • Gene synthesis with codon optimization for E. coli expression

  • Cloning into a vector containing an N-terminal His-tag or similar affinity tag

  • Expression in E. coli strains such as BL21(DE3) or C41(DE3)

  • Induction with IPTG at reduced temperatures (16-20°C) to enhance protein solubility

  • Membrane fraction isolation through differential centrifugation

This approach addresses the inherent difficulties in working with M. genitalium, which grows slowly and requires hyper-specific conditions, making direct isolation of native lgt impractical for most research applications .

What purification strategies yield functional recombinant M. genitalium lgt?

Purification of recombinant M. genitalium lgt requires specialized techniques due to its membrane-associated nature. A methodological approach includes:

Purification StepBuffer CompositionConditionsExpected Yield
Membrane extraction50 mM Tris-HCl pH 8.0, 150 mM NaClUltracentrifugation at 100,000×gMembrane pellet
SolubilizationBuffer + 1% DDM or 1% LDAO4°C, overnight stirring>90% of membrane-bound lgt
IMAC purificationBuffer + 0.05% DDM + 10-250 mM imidazoleGradient elution~5 mg/L culture
Size exclusionBuffer + 0.05% DDMSuperdex 200 column>95% purity

The critical factors for maintaining enzymatic activity include: (1) selection of appropriate detergents that mimic the native membrane environment, (2) inclusion of glycerol (10-15%) as a stabilizing agent, and (3) maintaining reducing conditions throughout purification to protect the catalytic cysteine residues .

How does antibiotic resistance impact research on M. genitalium lgt?

The rising antibiotic resistance in M. genitalium creates an urgent research imperative for alternative therapeutic targets like lgt. Current data indicates macrolide-resistance mutations in 48.8% of clinical samples and quinolone resistance in 23%, with co-resistance to both antibiotic classes reaching 21.2% . This resistance profile is particularly concerning as macrolide resistance exceeds 60% in Australia and 80% in men who have sex with men . The most prevalent resistance-conferring mutations include A2059C (18.2%) for macrolides and S83I (17.1%) for quinolones .

Researchers investigating lgt must consider these resistance patterns when developing experimental models, as resistant strains may exhibit altered membrane properties or compensatory mechanisms affecting lipoprotein processing. Additionally, the correlation between rectal samples and higher macrolide resistance (p < .05) suggests tissue-specific adaptation that may influence lgt activity or substrate specificity, requiring careful experimental design when evaluating lgt as a therapeutic target.

What enzymatic assays are most reliable for measuring M. genitalium lgt activity?

For precise quantification of M. genitalium lgt activity, multiple complementary assays are recommended:

  • Radiolabeled substrate assay:

    • Using [³H]-labeled phosphatidylglycerol as the diacylglyceryl donor

    • Synthetic peptides containing the lipobox motif as acceptor substrates

    • Quantification by scintillation counting after lipid extraction

  • Fluorescence-based assay:

    • FRET-based reporter peptides containing the lipobox sequence

    • Real-time monitoring of fluorescence change upon diacylglyceryl transfer

    • Suitable for high-throughput screening applications

  • Mass spectrometry assay:

    • LC-MS/MS detection of modified peptides

    • Most accurate for determining site-specific modification

    • Essential for confirming the exact position of diacylglyceryl attachment

When establishing these assays, researchers should account for the thermosensitive nature of M. genitalium, which may influence optimal reaction conditions compared to lgt enzymes from other bacteria. The optimal enzymatic assay conditions typically include pH 7.5-8.0, presence of divalent cations (Mg²⁺), and temperature of 30-37°C .

How does the structure of M. genitalium lgt compare to orthologs from other bacteria?

Structural analysis of M. genitalium lgt reveals distinctive features compared to other bacterial orthologs:

Bacterial SpeciesMolecular Weight (kDa)Transmembrane DomainsCatalytic ResiduesSubstrate Specificity
M. genitalium33.25H103, Y235, R239Narrower range
E. coli35.47H103, Y235, R246Broad range
S. aureus34.86H103, Y235, R241Intermediate range
M. tuberculosis54.68H144, Y318, R322Specialized for mycobacterial lipoproteins

The reduced size and fewer transmembrane domains in M. genitalium lgt reflect the minimal genome of this organism. These structural differences may be exploited for selective inhibition, as compounds targeting the unique molecular architecture of M. genitalium lgt could potentially achieve higher specificity. Additionally, the reduced substrate range correlates with M. genitalium's smaller proteome, with approximately 28 predicted lipoproteins compared to over 90 in E. coli .

How can site-directed mutagenesis inform mechanism studies of M. genitalium lgt?

Site-directed mutagenesis provides critical insights into the catalytic mechanism and substrate recognition determinants of M. genitalium lgt. A systematic approach should target:

  • Putative catalytic triad residues (H103, Y235, R239) to confirm their role in catalysis

  • Conserved residues in transmembrane domains for substrate binding analysis

  • Species-specific residues that may confer unique properties to M. genitalium lgt

Methodologically, researchers should:

  • Generate alanine scanning mutants across conserved regions

  • Develop more subtle mutations (H→N, Y→F, R→K) to probe specific catalytic contributions

  • Evaluate both kinetic parameters and thermostability for each mutant

  • Correlate functional changes with computational models

These studies can reveal whether M. genitalium lgt displays mechanistic peculiarities that might explain its persistence in infection despite antibiotic treatment. The highly inflammatory nature of M. genitalium infections, with 100% of positive samples showing elevated leukocyte infiltration , suggests potential unique interactions between lgt-modified lipoproteins and host immune recognition pathways.

What techniques are most effective for studying M. genitalium lgt-substrate interactions?

Due to the membrane-embedded nature of lgt, specialized techniques are required to characterize its interactions with substrates:

  • Microscale thermophoresis (MST):

    • Allows binding measurements in detergent solutions

    • Requires minimal protein quantities (nanomolar range)

    • Can detect interactions with both phospholipid and prolipoprotein substrates

  • Surface plasmon resonance (SPR) with nanodiscs:

    • Incorporation of purified lgt into nanodiscs provides a native-like membrane environment

    • Permits real-time binding analysis under controlled conditions

    • Enables determination of association/dissociation kinetics

  • Computational molecular dynamics:

    • Simulates substrate access channels within the membrane

    • Models conformational changes during catalysis

    • Predicts binding modes of potential inhibitors

These methods should be used in combination to overcome the limitations of studying a membrane protein like lgt. When designing these experiments, researchers should consider the high rate of macrolide resistance (>60% in Australia) as it may correlate with altered membrane composition that could influence lgt activity in resistant strains.

How can structural biology approaches advance M. genitalium lgt research?

Advanced structural biology techniques can overcome the challenges associated with membrane protein crystallization:

  • Cryo-electron microscopy (cryo-EM):

    • Enables structure determination without crystallization

    • Recent advances allow resolution of <3Å for membrane proteins

    • Can capture different conformational states during catalysis

  • X-ray crystallography with antibody fragments:

    • Use of crystallization chaperones to stabilize flexible regions

    • Incorporation of detergent-solubilized lgt into lipidic cubic phases

    • Potential for high-resolution structures (1.5-2.5Å)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps protein dynamics and conformational changes

    • Identifies regions involved in substrate binding

    • Complements static structural techniques

The structural information obtained through these methods can directly inform structure-based drug design efforts targeting M. genitalium lgt. Since current antibiotic resistance rates are alarmingly high (macrolide resistance >60%, quinolone resistance ~20%) , novel therapeutic approaches targeting essential enzymes like lgt represent a promising research direction.

How does M. genitalium's "stealth pathogen" nature impact lgt research?

M. genitalium's classification as a "stealth pathogen" has significant implications for lgt research. Studies show that 94.4% of men and 56.2% of women with M. genitalium infection display no symptoms , suggesting sophisticated mechanisms for immune evasion. Methodological approaches to address this challenge include:

  • Comparative analysis of lipoprotein profiles between symptomatic and asymptomatic infections

  • Investigation of lgt-modified lipoproteins for immunomodulatory properties

  • Development of in vitro models mimicking persistent infection conditions

Researchers must design experiments that account for the pathogen's ability to establish long-term infection without triggering overt immune responses. This stealth characteristic potentially involves selective modification of lipoproteins by lgt to avoid immune recognition while maintaining essential membrane functions.

What is the relationship between M. genitalium lgt activity and inflammatory responses?

Studies demonstrate a strong association between M. genitalium infection and inflammatory responses, with 100% of infected samples showing elevated leukocyte infiltration (leukocyte/epithelial cell ratio >2.0) . This inflammatory profile is significantly higher than that observed with other STIs, suggesting unique immunostimulatory properties of M. genitalium lipoproteins.

Research methodologies to investigate this relationship should include:

  • Comparison of inflammatory responses to wild-type versus lgt-deficient M. genitalium

  • Isolation and characterization of specific lgt-modified lipoproteins triggering inflammation

  • Analysis of TLR2/TLR6 activation by purified M. genitalium lipoproteins

  • Cell culture models using human epithelial and immune cells to measure cytokine responses

These approaches can reveal whether selective inhibition of lgt might reduce pathogen-induced inflammation while maintaining antimicrobial efficacy, potentially offering therapeutic advantages over current antibiotics that face increasing resistance challenges .

How can recombinant M. genitalium lgt contribute to diagnostic development?

Despite M. genitalium's growing clinical significance, diagnostic challenges persist due to its fastidious nature and the limited availability of sensitive testing methods. Recombinant lgt research can advance diagnostics through:

  • Development of serological assays targeting anti-lipoprotein antibodies:

    • Purified recombinant lipoproteins processed by lgt can serve as antigens

    • Potential for distinguishing current from past infections based on antibody profiles

    • May offer advantages over nucleic acid testing in certain clinical scenarios

  • Identification of unique lipoprotein biomarkers:

    • Mass spectrometry characterization of lgt-modified lipoproteins

    • Discovery of M. genitalium-specific lipoprotein signatures

    • Integration with current NAAT (Nucleic Acid Amplification Test) approaches

  • Antibiotic resistance correlation studies:

    • Investigation of relationships between lgt activity and macrolide/quinolone resistance

    • Potential development of functional assays to predict treatment response

These diagnostic applications are particularly relevant given that macrolide resistance exceeds 60% in Australia and 80% in men who have sex with men , highlighting the need for improved diagnostic approaches that can simultaneously detect infection and predict antibiotic susceptibility.

What screening approaches can identify selective inhibitors of M. genitalium lgt?

The development of selective inhibitors requires strategic screening approaches:

  • High-throughput fluorescence-based screening:

    • FRET-based assays to monitor lgt activity in real-time

    • Counter-screening against human enzymes to establish selectivity

    • Secondary validation using radiolabeled substrate assays

  • Fragment-based drug discovery:

    • NMR or thermal shift assays to identify initial fragment hits

    • Structure-guided fragment growing and linking

    • Particularly suitable for targeting the unique substrate binding pocket

  • Virtual screening with molecular docking:

    • In silico screening against homology models of M. genitalium lgt

    • Pharmacophore-based filtering to prioritize compounds

    • Molecular dynamics simulations to assess binding stability

When designing screening campaigns, researchers should prioritize compounds with activity against macrolide-resistant strains, which now represent the majority of clinical isolates in many regions (>60% resistance) .

Screening ApproachAdvantagesLimitationsHit Confirmation Method
HTS fluorescenceHigh throughput, real-timePotential false positivesOrthogonal biochemical assays
Fragment-basedEfficient sampling of chemical spaceRequires structural informationSPR, ITC, X-ray crystallography
Virtual screeningCost-effective, large librariesDepends on model accuracyBiochemical validation, binding studies

How do antimicrobial resistance mechanisms in M. genitalium influence lgt inhibitor research?

The rising antimicrobial resistance in M. genitalium provides strong motivation for exploring alternative targets like lgt. Current research shows:

  • Macrolide resistance:

    • Exceeds 60% in Australia and 80% in men who have sex with men

    • Primarily mediated by mutations in the 23S rRNA gene (A2059C being most common at 18.2%)

    • No direct impact on lgt function, making it an orthogonal target

  • Quinolone resistance:

    • Approaching 20% in many urban settings

    • Most commonly involves the S83I mutation (17.1%)

    • Independent of lgt-mediated processes

  • Co-resistance to both drug classes:

    • Now reaching 21.2% of clinical isolates

    • Creates urgent need for novel therapeutic approaches

Researchers developing lgt inhibitors should establish activity against isolates with defined resistance mutations and investigate potential synergistic effects when combined with existing antibiotics. The mechanism-based targeting of lgt provides a rational approach to overcome current resistance challenges, as modifications to the ribosome or DNA gyrase would not affect inhibitor binding to lgt.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.