Recombinant Mycoplasma genitalium Putative ABC transporter ATP-binding MG390 (MG390)

Shipped with Ice Packs
In Stock

Description

Biological Role in Mycoplasma genitalium

MG390 is implicated in:

  • Nutrient transport: Likely facilitates uptake of essential molecules (e.g., glycerol, metals) in M. genitalium, which lacks biosynthetic pathways for many metabolites .

  • Pathogenesis: ABC transporters in mycoplasmas contribute to virulence by importing host-derived nutrients and evading immune responses .

Table 1: Recombinant MG390 Variants and Production Systems

Host SystemGene NamePurityNotesSource
E. coli/YeastMG390≥85%Full-length protein
Cell-Free ExpressionMG390≥85%Partial sequence; no tag
Mammalian CellsMG390≥85%Used for structural studies

Key Functional Insights

  • Glycerol transport: Homologs in Mycoplasma gallisepticum (MalF) import glycerol, a critical carbon source, via ABC transporters .

  • Antimicrobial resistance: Mutations in ABC transporters (e.g., 23S rRNA, parC) correlate with macrolide and fluoroquinolone resistance in M. genitalium .

  • Drug interaction assays: Recombinant ABC transporters are used in vesicular transport studies to evaluate substrate/inhibitor potential .

Clinical and Mechanistic Relevance

  • STI associations: M. genitalium infections are linked to urethritis, pelvic inflammatory disease, and increased HIV susceptibility .

  • Therapeutic targeting: ABC transporters like MG390 are potential targets for disrupting bacterial nutrient uptake or countering efflux-mediated drug resistance .

Comparative Analysis with Other ABC Transporters

  • Structural studies: High-resolution crystallography of MG390 could clarify its substrate-binding and ATPase mechanisms .

  • Antimicrobial development: Screening inhibitors against recombinant MG390 may yield novel therapeutics for resistant M. genitalium strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MG390; Putative ABC transporter ATP-binding MG390
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-660
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG390
Target Protein Sequence
MKIIYQEQQNECGICVIGMLANAIHDEKYVHDELLEQINLPPNGLSLFEMESYGKKFGLE INSYQLTFQELKELDSKFIIVHFKDHFVIVKNKHENSWEVYDPAKGKYLLTDEKLEKLWT GYAATVAKAFKEIPPVNKSNFFSNFFDFNLVTFYVFIELIIIGISTLLATASRTIITNTV DFGTAVNLVVLVVYFSCLKGLNLLLQVILQLIRNFLFWKQYRGYLGWIIQSLQQKSFVYF SNKSPNQLIERQFYLKEVLSFFNFYIPNLIISCVVALIIGVLIGINQLEFLLIAIAQIVV NAGLFCYDFFFTKKITKKEIPYVELQNKISLQLDENLREEQNKKRFNFLMLNFRKALLQN QNINNQKEINRLTIENIKSFFQQGFDFAILGLGVIGIIEQRYQLSFLFYVFGIQSLFSTY ATRIVQFGAAINIYHYCREKLVNLFIETKKDEGIKVNWQCPDEISLENLSVTLNQHVDLA NLSLKIKNETVIFGQNGSGKSTFLKILTGRGFEYTGNIKFNNVDLKRCSKEQLFENVYYL KGQNLMQTEANDFGFSEALFNNQNPHIYQLLFDAGVQNQTKLSSGQKQILQLFLLSNIKN KVILLDECMNAIAPEIKNRVYQLLVKPLTLNNFVVLVEHDLSFASEAQNKINLTNYLRNS
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_390

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of MG390 in Mycoplasma genitalium?

MG390 is classified as a putative ATP-binding cassette (ABC) transporter. ABC transporters function as ATP-driven efflux pumps that export various compounds across cellular membranes. These transporters typically contain multiple transmembrane domains and nucleotide-binding domains that hydrolyze ATP to power substrate transport . In pathogenic organisms like M. genitalium, ABC transporters may play crucial roles in nutrient acquisition, drug resistance, or export of virulence factors. Structural analysis would likely reveal the characteristic Walker A and Walker B motifs found in the nucleotide-binding domains of ABC transporters.

How does MG390 compare to other characterized ABC transporters in pathogenic bacteria?

  • Multiple sequence alignments to identify conserved domains

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural modeling based on crystallized ABC transporters

  • Functional predictions based on conserved motifs and domains

What experimental approaches are recommended for expressing recombinant MG390?

For successful expression of recombinant MG390, researchers should consider:

  • Expression system selection: E. coli systems (BL21, Rosetta) for high yield; mammalian or insect cell systems for proper folding of membrane proteins

  • Construct design: Inclusion of affinity tags (His, FLAG) for purification while ensuring tags don't interfere with protein function

  • Solubilization strategies: Use of appropriate detergents (DDM, LDAO) for membrane protein extraction

  • Expression conditions: Optimization of induction parameters (temperature, inducer concentration, duration)

  • Purification protocol: Typically involving immobilized metal affinity chromatography followed by size exclusion chromatography

How should researchers design experiments to verify the ATP-binding function of MG390?

To confirm ATP-binding activity, a structured experimental approach is necessary:

TechniqueMethodologyExpected OutcomeLimitations
ATP-agarose binding assayIncubate purified MG390 with ATP-coupled agarose, elute with free ATPSpecific binding and elution indicates ATP-binding capabilityMay detect non-specific interactions
Isothermal titration calorimetry (ITC)Measure heat changes during ATP binding to MG390Quantitative binding parameters (Kd, ΔH, ΔS)Requires significant amounts of purified protein
Fluorescence spectroscopyMeasure changes in intrinsic tryptophan fluorescence upon ATP bindingConformational changes upon ATP bindingIndirect measure of binding
ATPase activity assayMeasure phosphate release using colorimetric assaysATP hydrolysis ratesActivity may require additional cofactors

The experimental design should include appropriate controls such as known ATP-binding proteins and ATP-binding site mutants of MG390 .

What approaches can be used to determine the substrate specificity of the MG390 transporter?

Determining substrate specificity for ABC transporters requires:

  • Transport assays: Using radiolabeled or fluorescently-labeled potential substrates to measure uptake/export in reconstituted systems or whole cells expressing MG390

  • Competition assays: Testing whether unlabeled compounds compete with transport of labeled substrates

  • Binding studies: Direct binding measurements using techniques like surface plasmon resonance or microscale thermophoresis

  • Comparative genomics: Analysis of MG390 homologs with known substrates

  • Gene knockout/complementation: Phenotypic analysis of MG390 deletion mutants, particularly examining sensitivity to potential toxic substrates

Similar to studies on plant ABC transporters like AtPDR12, which showed enhanced susceptibility to compounds like sclareol when the gene was disrupted , researchers should examine whether MG390 mutants show altered sensitivity to antimicrobial compounds or host defense molecules.

How can researchers establish appropriate models to study MG390 function in the context of host-pathogen interactions?

When studying MG390's role in host-pathogen interactions, researchers should consider:

  • Cell culture models: Human genital epithelial cell lines (ecto/endocervical, vaginal) similar to those used in TLR studies

  • Infection assays: Measuring adhesion, invasion, and persistence of wild-type versus MG390 mutant strains

  • Immune response measurements: Quantifying cytokine production (IL-6, IL-8) and NF-κB activation in response to infection

  • Ex vivo tissue models: Using primary tissue explants to better represent the in vivo environment

  • Animal models: When available and ethically approved

The experimental design should include appropriate controls and careful consideration of M. genitalium growth requirements, as this organism is fastidious and slow-growing.

What strategies should be employed to overcome challenges in studying membrane proteins from Mycoplasma genitalium?

Mycoplasma membrane proteins present specific challenges requiring tailored approaches:

  • Genome-based prediction refinement: Use multiple bioinformatic tools to predict transmembrane domains, as mycoplasmas have unusual membrane compositions

  • Specialized expression systems: Consider cell-free systems or specialized strains designed for membrane protein expression

  • Nanodiscs or liposome reconstitution: To maintain native-like lipid environments for functional studies

  • Cryo-electron microscopy: For structural determination, avoiding crystallization challenges

  • Split-protein complementation assays: For studying protein-protein interactions involving MG390

  • Detergent screening: Systematic testing of detergents for optimal solubilization while maintaining function

These approaches must account for the unique membrane composition of mycoplasmas, which lack a cell wall and have unusual membrane lipids.

How can researchers effectively analyze contradictory data when studying MG390 function?

When faced with contradictory results regarding MG390 function, researchers should:

  • Systematically evaluate experimental conditions: Identify variables that differ between contradictory experiments (pH, temperature, buffer composition)

  • Consider protein conformational states: ABC transporters cycle through different conformations; contradictory results may reflect different states

  • Validate using multiple techniques: Confirm findings using orthogonal methods

  • Examine post-translational modifications: Check if differences in protein modifications explain functional variations

  • Statistical rigor: Apply robust statistical analyses to determine if differences are significant, following principles outlined for toxicogenomic experiments

  • Meta-analysis approaches: If multiple studies exist, apply methodological study approaches to synthesize findings

This systematic approach helps distinguish genuine biological complexity from experimental artifacts.

What state-of-the-art techniques are recommended for investigating the role of MG390 in antimicrobial resistance?

To investigate MG390's potential role in antimicrobial resistance:

  • Directed evolution experiments: Expose M. genitalium to increasing concentrations of antimicrobials and sequence MG390 from resistant strains

  • CRISPR interference (CRISPRi): For conditional knockdown of MG390 expression to assess impact on antimicrobial susceptibility

  • Heterologous expression: Express MG390 in susceptible bacteria to determine if it confers resistance

  • Real-time efflux assays: Using fluorescent substrates to directly measure export activity

  • Structural biology approaches: To identify antimicrobial binding sites within the transporter

  • Transcriptomics: RNA-seq to determine if MG390 expression changes in response to antimicrobial exposure

These approaches should be integrated with appropriate controls and carefully designed experimental protocols to ensure reliable and reproducible results.

How can researchers determine if MG390 contributes to Mycoplasma genitalium pathogenesis?

To establish MG390's role in pathogenesis:

  • Gene knockout/knockdown: Generate MG390-deficient mutants and assess virulence phenotypes

  • Adhesion and invasion assays: Compare wild-type and mutant strains' ability to adhere to and invade human genital epithelial cells

  • Immune response analysis: Measure cytokine production and NF-κB activation in response to wild-type versus mutant strains, similar to studies done with MG309

  • Transcriptomics: RNA-seq analysis of host cells infected with wild-type versus MG390 mutants

  • In vivo infection models: When available and ethically approved, compare infection dynamics

Results should be interpreted in the context of M. genitalium's known pathogenic mechanisms, including its ability to activate TLR2/6 signaling pathways .

What approaches are recommended for studying potential interactions between MG390 and host immune components?

To investigate interactions with the host immune system:

  • Pull-down assays: Using tagged MG390 to identify interacting host proteins

  • Yeast two-hybrid or mammalian two-hybrid screens: To identify protein-protein interactions

  • ELISA-based binding assays: To test direct binding to specific immune components

  • Reporter cell lines: Using cells expressing specific immune receptors (TLRs, NLRs) to detect activation

  • Cytokine profiling: Measuring production of inflammatory mediators in response to purified MG390

  • Immunofluorescence microscopy: To visualize colocalization of MG390 with host immune components

These approaches should be designed with appropriate controls, including other M. genitalium proteins and known immune activators like MG309 .

How should researchers design experiments to identify potential inhibitors of MG390 function?

To identify and characterize MG390 inhibitors:

Screening ApproachMethodologyAdvantagesLimitations
High-throughput ATPase assayMeasure inhibition of ATP hydrolysis in microplate formatDirect measure of functional inhibitionMay miss inhibitors that don't affect ATPase activity
Transport inhibition assayMeasure inhibition of substrate transportFunctional relevanceRequires knowledge of transported substrates
Fragment-based screeningNMR or X-ray crystallography to identify small molecule bindersCan identify novel chemical scaffoldsRequires structural information
Virtual screeningComputational docking of compounds to MG390 modelCost-effective initial screeningDepends on model accuracy
Phenotypic screeningTest compounds for ability to sensitize M. genitalium to antimicrobialsIdentifies compounds with biological relevanceIndirect measure of MG390 inhibition

Follow-up characterization should include selectivity profiling, mechanism of action studies, and preliminary toxicity assessment in human cell lines.

What statistical approaches are recommended for analyzing data from MG390 functional studies?

Researchers should apply rigorous statistical methods:

Statistical approaches should be determined during experimental design, not after data collection, following principles outlined for methodological studies in health research .

How can researchers effectively integrate structural predictions with functional data for MG390?

To integrate structural and functional data:

  • Structure-function mapping: Correlate functional effects of mutations with their positions in structural models

  • Molecular dynamics simulations: Use functional data to validate and refine structural models

  • Ligand docking studies: Integrate transport assay data with computational docking results

  • Evolutionary conservation analysis: Correlate conserved regions with functionally important sites

  • Network analysis: Map interactions between structural domains and their functional relevance

  • Integrative modeling: Combine data from multiple experimental approaches (cryo-EM, cross-linking, functional assays) to generate comprehensive models

This integrated approach provides more robust insights than either structural or functional data alone.

What are the most promising approaches for developing MG390 as a therapeutic target?

Future research directions for therapeutic development include:

  • Structure-based drug design: Once high-resolution structures are available

  • Peptidomimetics: Design of peptides that interfere with MG390 function or interactions

  • Allosteric modulators: Identification of compounds that bind outside the ATP-binding site

  • Combination approaches: Testing MG390 inhibitors with current antibiotics for synergistic effects

  • Host-directed therapies: Targeting host factors that interact with MG390

  • PROTAC approach: Development of proteolysis-targeting chimeras for MG390 degradation

Researchers should consider the potential role of MG390 in antibiotic resistance and virulence when developing therapeutic strategies, similar to how other ABC transporters have been implicated in host-pathogen interactions .

How might systems biology approaches enhance our understanding of MG390 in the context of Mycoplasma genitalium pathogenesis?

Systems biology approaches offer comprehensive insights:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data

  • Network analysis: Mapping MG390's position in protein-protein interaction networks

  • Flux balance analysis: Modeling metabolic impacts of MG390 function

  • Host-pathogen interaction modeling: Computational simulation of infection dynamics

  • Machine learning approaches: Pattern recognition in complex datasets to identify non-obvious relationships

  • Comparative systems analysis: Examining MG390 function across different strains or related species

These approaches help contextualize MG390's role within the broader pathogenic mechanisms of M. genitalium, including its interaction with host immune receptors like TLR2/6 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.