Recombinant Mycoplasma genitalium Putative ABC transporter ATP-binding protein MG014 (MG014)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Properties

MG014 is a recombinant protein corresponding to the full-length ATP-binding component (ABP) of an ABC transporter in Mycoplasma genitalium. ABC transporters are membrane-bound efflux pumps critical for multidrug resistance (MDR) in bacteria. MG014 (UniProt ID: P47260) spans 623 amino acids (aa) and contains conserved Walker A/B motifs and the ABC signature sequence, hallmark features of ATP-binding domains .

Key Biochemical Characteristics

PropertyDetailSource
Protein LengthFull-length (1–623 aa)
Molecular Weight~68.3 kDa (calculated from aa sequence; not experimentally verified)
TagN-terminal His-tag for purification
Purity>90% (SDS-PAGE)
Source OrganismMycoplasma genitalium (strain ATCC 33530/G-37/NCTC 10195)

Production Workflow

  1. Cloning: MG014 gene amplified from M. genitalium genomic DNA.

  2. Expression: Hosted in E. coli under optimized conditions.

  3. Purification: Affinity chromatography via His-tag.

  4. Lyophilization: Stabilized in trehalose (6%) and Tris/PBS buffer (pH 8.0) .

Functional Role and Research Findings

MG014 is part of an ABC transporter system implicated in multidrug resistance. In M. genitalium, adjacent genes mg014 and mg015 encode ATP-binding and permease subunits, respectively .

Key Research Insights

  1. MDR Mechanism:

    • ABC transporters actively efflux antibiotics like fluoroquinolones and macrolides.

    • Overexpression of mg014 correlates with reduced intracellular drug accumulation .

  2. Genomic Context:

    • mg014 and mg015 are transcriptionally linked, forming an operon with overlapping stop/start codons .

  3. Evolutionary Conservation:

    • Shares structural homology with ABC transporters in Enterococcus faecalis (EfrAB) and Lactococcus lactis (LmrA) .

Clinical Implications and Antimicrobial Resistance

M. genitalium infections are increasingly associated with antibiotic resistance, driven by ABC transporter activity. While MG014 itself is not directly targeted in therapy, its role in efflux pumps informs resistance management:

Antibiotic ClassResistance MechanismRelevance to MG014
MacrolidesMutations in 23S rRNA (e.g., A2058G)Indirect (efflux)
FluoroquinolonesMutations in parC (QRDR) or gyrADirect (efflux)
TetracyclinesRibosomal protection proteins or efflux (e.g., Tet(M))Potential role

Surveillance data from the UK (2023) highlights macrolide resistance in ~20–50% of M. genitalium cases, underscoring the need for ABC transporter-targeted therapies .

Applications in Research and Development

MG014 serves as a tool for studying:

  1. ABC Transporter Dynamics: Structure-function analysis of ATP hydrolysis and substrate binding.

  2. Drug Resistance Models: Screening for efflux pump inhibitors.

  3. Vaccine Development: Immunogenicity profiling of MG014 as a potential target.

Challenges and Gaps

  • Limited structural data for M. genitalium ABC transporters.

  • Unclear substrate specificity of MG014 (e.g., does it pump antibiotics, ions, or metabolites?).

  • No direct therapeutic targeting strategies reported to date .

Future Directions

  1. Targeted Inhibitors: Develop small molecules to block MG014-mediated efflux.

  2. Synergistic Therapies: Combine ABC transporter inhibitors with antibiotics to enhance efficacy.

  3. Diagnostic Biomarkers: Utilize MG014 expression levels as a resistance indicator .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MG014; Putative ABC transporter ATP-binding protein MG014
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG014
Target Protein Sequence
MGLVLKEFNNKIRTALILAPFFTFAQIVIDLIIPSFLASAISVVFSIDKLKQDESGGKTI SVDFIGGANINFANVREAQIVLATTVILLALCGLFFGLISIYCASYVSANTSFLLRKKIF AKLMRITTPSHDHYGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPLLFIGGLVFAVTTNQ DMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSF TNNKFKIANEGWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSVSVDPLPQD AAIRPNIFAFFQYNFYIVLGFILTSLTMVNFNRSRVALGRIKDILSQPEIKTITNKDQKE LLPTLEFRNISFGLGNKNNNNFLQNLSFKFEAYKTYGIVGPTGSGKSLIANIIGGLYEPN EGEILIGGEKIQSIDSLYLSEMIGIVFQQNILFKGTISSNIKIGIETRSDWKNQSDLQKN EAMKNAAKIACADTFIEKFSDSYDHNVEQLGKNLSGGQKQRVAIARTLITKPRILVFDDS MSALDALTEKKVRENIENDLKLTTKIIISQNINSIKHADKILVIDNGRIVGFDSDQKLMK NCSLYQKMKESQKDLGGDFDAVN
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma genitalium and why is it significant for MG014 research?

Mycoplasma genitalium is a small-sized, sexually transmitted bacterial pathogen that causes urethritis in males and cervicitis in females. Its significance stems from several factors that make it an important research subject:

  • The pathogen has developed resistance to commonly used antibiotics, creating challenges in treatment and management

  • Its small genome makes it an excellent model organism for studying minimal genetic requirements for cellular life

  • The difficulty in diagnosis, treatment, and control of this infection has led researchers to explore alternative management strategies such as vaccination

  • Understanding proteins like MG014 from this organism provides insights into bacterial survival mechanisms and potential therapeutic targets

Mycoplasma genitalium has been identified as a significant public health concern due to its widespread prevalence and the complications associated with untreated infections .

What is the structure and function of ABC transporters like MG014?

ATP-binding cassette (ABC) transporters are a universal class of membrane proteins found across all living organisms. The MG014 protein is classified as a putative ABC transporter ATP-binding protein based on sequence homology and structural predictions. These transporters share several key structural and functional characteristics:

  • They consist of two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and two transmembrane domains (TMDs) that form a pathway for substrate translocation

  • The NBDs contain several highly conserved motifs including the Walker A motif, Walker B motif, LSGGQ signature motif, H loop, and D loop

  • ATP binds at the interface between two NBDs, with each binding site formed by residues from both subunits, creating a "head-to-tail" arrangement

  • Energy from ATP binding and hydrolysis drives conformational changes that enable substrate transport across membranes

  • ABC transporters can function as importers (bringing substrates into cells) or exporters (removing substances from cells)

In bacterial pathogens like Mycoplasma genitalium, ABC transporters play crucial roles in nutrient acquisition, toxin export, and antibiotic resistance, making them important for bacterial survival and virulence .

How has MG014 been identified as a potential vaccine candidate?

MG014 has emerged as a promising vaccine target through comprehensive computational immunoinformatics approaches. Researchers have identified MG014 as one of three shortlisted vaccine proteins (along with MG015 and Hmw3MG317) through the following analytical process:

  • Proteomic sequence data analysis to identify proteins exposed on the bacterial surface

  • Application of reverse vaccinology principles to prioritize proteins with high antigenicity and low similarity to human proteins

  • Prediction of B-cell and T-cell epitopes from the shortlisted proteins

  • Evaluation of physicochemical parameters including allergenicity, antigenicity, theoretical pI, GRAVY, and molecular weight

  • Construction of multi-epitope vaccine candidates containing both cytotoxic and helper T cell epitopes from these proteins

  • Computational validation of immune responses through immune simulation studies

These comprehensive analyses identified MG014 as a potential vaccine antigen capable of inducing both cellular and antibody-mediated immune responses against Mycoplasma genitalium .

What methodologies are most effective for expressing and purifying recombinant MG014 protein?

Successful expression and purification of recombinant MG014 protein requires careful optimization of several parameters:

Expression System Selection:

  • Escherichia coli K-12 strain has been demonstrated as an effective host for MG014 expression when cloned into vectors like pET28a(+)

  • The expression system should include a histidine tag for affinity purification and appropriate promoters for controlled expression

  • Expression in bacterial systems must account for potential differences in codon usage between Mycoplasma genitalium and the host organism

Optimization Protocol:

  • Clone the MG014 gene into pET28a(+) vector with appropriate restriction sites

  • Transform into E. coli K-12 strain

  • Induce expression with IPTG at optimal concentration (typically 0.5-1.0 mM)

  • Harvest cells and lyse using appropriate buffers containing protease inhibitors

  • Purify using nickel affinity chromatography followed by size exclusion chromatography

Purification Considerations:

  • Include 1mM PBS with 0.05% BSA and 0.05% azide in storage buffers to maintain protein stability

  • Aliquot and store at -20°C for long-term storage, and at 2-4°C for short-term use

  • Validate protein purity using SDS-PAGE and Western blot analysis

  • Confirm protein activity using ATP binding and hydrolysis assays

This methodology has been validated through computational expression studies demonstrating successful expression of vaccine constructs containing MG014 epitopes in E. coli .

How do ATP binding and hydrolysis drive conformational changes in ABC transporters like MG014?

The mechanism by which ATP binding and hydrolysis drive conformational changes in ABC transporters like MG014 involves a complex series of molecular events:

ATP Binding Mechanism:

  • ATP binds at the interface between two nucleotide-binding domains (NBDs)

  • The adenosine ring is stabilized by a ring-stacking interaction with a conserved aromatic residue preceding the Walker A motif

  • The conserved lysine in the Walker A motif forms hydrogen bonds with oxygen atoms of the α- and γ-phosphates

  • A Mg²⁺ ion is coordinated by oxygen atoms from the β- and γ-phosphates and residues in the Walker A motif

  • The LSGGQ motif from the opposite subunit coordinates the γ-phosphate

Conformational Changes During Transport Cycle:

  • In the resting state, the two NBDs are separated

  • ATP binding induces closure of the NBDs, bringing them together in a dimeric arrangement

  • The helical domain rotates toward the RecA-like domain upon ATP binding

  • ATP hydrolysis triggers reopening of the NBDs, with the helical domain rotating away from the active site

  • ADP release returns the transporter to its resting state

Tweezer-like Motion Model:
The NBDs exhibit a tweezer-like motion during the transport cycle, as evidenced in MalK (a well-studied ABC transporter):

  • In nucleotide-free structures, the NBDs are separated

  • In ATP-bound form, the NBDs make contact with two ATPs buried along the dimer interface

  • In ADP-bound form, the NBDs separate similar to the resting state

  • These conformational changes are propagated to the transmembrane domains to facilitate substrate transport

What computational approaches are most effective for predicting epitopes from MG014 for vaccine development?

Effective computational approaches for predicting epitopes from MG014 involve a multi-step immunoinformatics pipeline:

B-cell Epitope Prediction:

  • Surface accessibility analysis using algorithms like Emini Surface Accessibility Prediction

  • Flexibility prediction using Karplus and Schulz Flexibility Prediction

  • Hydrophilicity analysis using Parker Hydrophilicity Prediction

  • Antigenicity assessment using tools like VaxiJen and ANTIGENpro

  • Consensus approach combining multiple prediction methods to increase accuracy

T-cell Epitope Prediction:

  • MHC-I binding prediction for cytotoxic T-cell epitopes using tools like NetMHCpan

  • MHC-II binding prediction for helper T-cell epitopes using IEDB analysis resources

  • Immunogenicity prediction using IEDB immunogenicity prediction tools

  • Population coverage analysis to ensure broad effectiveness across diverse HLA alleles

Epitope Validation and Refinement:

  • Conservation analysis across Mycoplasma genitalium strains

  • Exclusion of epitopes with significant homology to human proteins

  • Molecular dynamics simulations to assess stability of predicted epitopes

  • Docking studies to evaluate binding affinity with immune receptors

Vaccine Construct Design:

  • Strategic selection of epitopes with optimal predicted immunogenicity

  • Joining epitopes using appropriate linkers to maintain individual epitope integrity

  • Addition of adjuvant sequences like TLR agonists to enhance immune response

  • Molecular docking to validate binding with immune receptors like TLR1/2 heterodimer

This comprehensive computational approach has been successfully applied to identify promising epitopes from MG014 and other Mycoplasma genitalium proteins for vaccine development .

How does ATP hydrolysis at the two nucleotide-binding sites of ABC transporters coordinate during the transport cycle?

The coordination of ATP hydrolysis at the two nucleotide-binding sites of ABC transporters is a complex process with important implications for understanding MG014 function:

Cooperative ATP Binding and Hydrolysis:

ABC transporters demonstrate positive cooperativity in ATP hydrolysis, meaning the binding of ATP at one site enhances binding at the second site. This cooperativity is evident in the following table comparing different ABC transporters:

ABC TransporterCooperative ATP BindingCooperative ATP HydrolysisKm for ATP (μM)Hill Coefficient
Maltose transporterYesYes100-3001.7-2.0
Histidine transporterYesYes200-5001.4-1.8
MG014 (predicted)YesLikelyUnknownUnknown

Asymmetric vs. Symmetric Hydrolysis:

  • Some ABC transporters hydrolyze ATP at both sites during each transport cycle

  • Others may alternate between sites, hydrolyzing ATP at only one site per cycle

  • For example, mutation of the catalytic histidine in a single site of the maltose transporter severely impairs function, suggesting both sites must hydrolyze ATP

  • In contrast, the histidine transporter tolerates mutation in one site, suggesting asymmetric hydrolysis may be sufficient

Molecular Dynamics and Conformational Coupling:

  • Molecular dynamics simulations suggest asymmetries may develop during the catalytic cycle

  • Movement within one helical domain may loosen interaction between the ADP-bound monomer and the transmembrane domain

  • Some models suggest only simultaneous opening of both ATP-binding sites triggers appropriate conformational changes in the membrane regions

  • The transmembrane domains can influence the cooperativity between nucleotide-binding sites

The exact mechanism in MG014 remains to be experimentally determined, but understanding these principles from well-characterized ABC transporters provides a framework for future studies on MG014 function .

What role might MG014 play in antibiotic resistance in Mycoplasma genitalium?

As an ABC transporter ATP-binding protein, MG014 potentially contributes to antibiotic resistance in Mycoplasma genitalium through several mechanisms:

Potential Antibiotic Efflux Function:

  • If MG014 forms part of an efflux system, it could actively pump antibiotics out of bacterial cells

  • The ATP binding and hydrolysis function would provide energy for this efflux

  • Similar ABC transporters in other bacteria have been shown to export macrolides, fluoroquinolones, and tetracyclines

Impacts on Membrane Permeability:

  • ABC transporters can influence membrane composition by transporting lipids

  • Altered membrane composition can reduce antibiotic penetration

  • MG014 might contribute to maintaining membrane integrity under antibiotic stress

Relevance to Treatment Failure:

  • Mycoplasma genitalium has been documented as resistant to multiple antibiotics

  • Treatment failure is increasingly common, with resistance to macrolides and fluoroquinolones

  • Understanding MG014's role could help develop strategies to overcome resistance

Research Directions:

  • Comparative studies between antibiotic-sensitive and resistant strains focusing on MG014 expression levels

  • Analysis of MG014 mutations in resistant strains

  • Development of specific inhibitors targeting MG014 to potentially restore antibiotic sensitivity

Understanding MG014's potential contribution to antibiotic resistance is particularly important given the increasing difficulty in treating Mycoplasma genitalium infections and the limited therapeutic options available .

What techniques are most appropriate for studying MG014 structure-function relationships?

Multiple complementary techniques should be employed to comprehensively understand MG014 structure-function relationships:

Structural Determination Methods:

  • X-ray crystallography of purified MG014 in various nucleotide-bound states (apo, ATP-bound, ADP-bound)

  • Cryo-electron microscopy for visualization of MG014 in membrane environment

  • Nuclear magnetic resonance (NMR) spectroscopy for dynamic studies

  • Molecular modeling and homology modeling based on related ABC transporters

Functional Assays:

  • ATPase activity assays using colorimetric phosphate detection

  • Nucleotide binding assays using fluorescent ATP analogs

  • Transport assays using reconstituted proteoliposomes

  • Mutational analysis targeting conserved motifs (Walker A, Walker B, LSGGQ)

Conformational Dynamics Studies:

  • Hydrogen/deuterium exchange mass spectrometry to monitor conformational changes

  • Fluorescence resonance energy transfer (FRET) to measure distances between domains

  • Electron paramagnetic resonance (EPR) spectroscopy with spin labels

  • Single-molecule studies to observe individual transport events

Computational Approaches:

  • Molecular dynamics simulations to study conformational changes during transport cycle

  • Normal mode analysis to identify important collective motions

  • Quantum mechanics/molecular mechanics calculations for ATP hydrolysis mechanism

  • Bioinformatic analysis comparing MG014 with other ABC transporters

Integration of these methodologies provides a comprehensive understanding of how MG014 structure relates to its function in Mycoplasma genitalium .

How can immune responses to MG014-based vaccine constructs be effectively evaluated?

Evaluation of immune responses to MG014-based vaccine constructs requires a comprehensive approach spanning computational prediction, in vitro validation, and in vivo assessment:

Computational Immune Response Prediction:

  • Immunoinformatics tools can predict population coverage based on epitope binding to diverse HLA alleles

  • Immune simulation using tools like C-ImmSim can model expected responses

  • Molecular docking with immune receptors can predict binding affinity

In Vitro Assays:

  • Antigen Presentation Assays:

    • Dendritic cell activation and maturation in response to MG014 epitopes

    • MHC binding assays to confirm predicted epitope-MHC interactions

  • T-Cell Response Assays:

    • T-cell proliferation assays

    • Cytokine profiling (IFN-γ, IL-2, TNF-α, IL-4, IL-10)

    • ELISPOT assays for quantifying epitope-specific T cells

  • B-Cell Response Assays:

    • ELISA to measure antibody titers

    • Antibody isotyping to characterize response quality

    • Neutralization assays to assess functional antibody responses

In Vivo Assessment:

  • Animal Model Studies:

    • Immunization protocols with appropriate adjuvants

    • Monitoring antibody development over time

    • Challenge studies to assess protection

    • Histopathology to evaluate tissue responses

  • Immune Response Parameters to Measure:

    • Humoral immunity (antibody titers, affinity maturation)

    • Cell-mediated immunity (T-cell responses)

    • Memory response development

    • Protection against challenge

Monitoring for Adverse Effects:

  • Local and systemic reactogenicity

  • Hypersensitivity responses

  • Autoimmune indicators

The integrated approach ensures thorough evaluation of both the safety and efficacy of MG014-based vaccine constructs before advancing to human trials .

What are the most promising approaches for targeting MG014 in therapeutic development?

Several innovative approaches show promise for targeting MG014 in therapeutic development:

Small Molecule Inhibitors:

  • Structure-based design of ATP-competitive inhibitors targeting the nucleotide-binding domain

  • Allosteric inhibitors that prevent conformational changes required for transport

  • Fragment-based drug discovery to identify novel binding sites

Peptide-Based Approaches:

  • Peptide inhibitors designed to mimic conserved motifs and disrupt protein-protein interactions

  • Cell-penetrating peptides coupled with inhibitory domains

  • Stapled peptides with enhanced stability and cellular penetration

Nucleic Acid-Based Therapeutics:

  • Antisense oligonucleotides targeting MG014 mRNA

  • CRISPR-Cas systems for gene editing to disrupt MG014 function

  • RNA interference approaches using small interfering RNAs

Immunotherapeutic Strategies:

  • Therapeutic vaccines based on MG014 epitopes

  • Monoclonal antibodies targeting exposed regions of MG014

  • T-cell based therapies directed against MG014-expressing bacteria

Combination Approaches:

  • MG014 inhibitors combined with conventional antibiotics

  • Dual targeting of multiple ABC transporters

  • Targeting MG014 along with bacterial attachment mechanisms

These diverse approaches provide multiple avenues for therapeutic development, with the potential to address the growing challenge of antibiotic resistance in Mycoplasma genitalium infections .

What are the critical knowledge gaps in understanding MG014 function and regulation?

Despite advances in ABC transporter research, several critical knowledge gaps remain regarding MG014 function and regulation:

Structural Uncertainties:

  • High-resolution structure of full-length MG014 in different conformational states

  • Details of interaction between MG014 and its transmembrane partners

  • Substrate binding site architecture and specificity determinants

Functional Questions:

  • Identity of natural substrates transported by MG014-containing complexes

  • Contribution to Mycoplasma genitalium virulence and pathogenesis

  • Role in stress responses and adaptation to host environment

Regulatory Mechanisms:

  • Transcriptional regulation of MG014 expression under different conditions

  • Post-translational modifications affecting MG014 activity

  • Protein-protein interactions modulating transport function

Comparative Aspects:

  • Functional differences between MG014 and homologous proteins in other bacteria

  • Evolution of substrate specificity in Mycoplasma genitalium ABC transporters

  • Structural adaptations related to the minimal genome of Mycoplasma genitalium

Therapeutic Implications:

  • Druggability of different domains and conformational states

  • Potential for resistance development against MG014-targeted therapeutics

  • Cross-reactivity concerns for immunological approaches

Addressing these knowledge gaps requires integrated approaches combining structural biology, biochemistry, microbiology, and computational methods to fully understand MG014's role in Mycoplasma genitalium biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.