Recombinant Mycoplasma genitalium Putative ABC transporter ATP-binding protein MG015 (MG015)

Shipped with Ice Packs
In Stock

Description

Functional Role in M. genitalium

MG015 is implicated in:

  • Multidrug Resistance (MDR): ABC transporters like MG015 efflux antimicrobial agents (e.g., fluoroquinolones, ethidium bromide) via ATP-driven conformational changes .

  • Pathogen Survival: Overexpression of homologous genes (md1/md2 in M. hominis) correlates with reduced drug uptake and increased MICs .

  • Operon Organization: mg015 overlaps with mg014 by 8 nucleotides, suggesting coordinated regulation .

Recombinant Production and Applications

Recombinant MG015 is commercially produced for research purposes. Key details include:

ParameterSpecification
Host SystemE. coli
TagN-terminal His tag
Applications- Mechanistic studies of ABC transporters
- Antibiotic resistance screening

4.1. Expression and Overexpression

  • In M. hominis, homologous genes (md1/md2) showed 2–10× increased expression in ethidium bromide-resistant strains, directly linked to reduced ciprofloxacin uptake .

  • MG015’s ATPase activity drives substrate translocation via a "power stroke" mechanism, involving ATP binding, NBD dimerization, and transmembrane helix reorientation .

Implications for Antimicrobial Resistance

  • Clinical Relevance: Overexpression of ABC transporters like MG015 complicates treatment of M. genitalium infections, particularly with rising macrolide and fluoroquinolone resistance .

  • Diagnostic Targets: Genetic variation in ABC transporter operons (e.g., MgPa operon) necessitates NAAT-based detection to avoid false-negative results in PCR assays .

Future Research Directions

  • Gene Knockout Studies: Require advanced genetic tools to confirm MG015’s role in drug efflux .

  • Structural Biology: Cryo-EM or X-ray crystallography of MG015 could elucidate substrate-binding pockets for inhibitor design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For shipments requiring dry ice, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For optimal long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
MG015; Putative ABC transporter ATP-binding protein MG015
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG015
Target Protein Sequence
MEGSWSYKLLYVFLCIVLGILYGIANPILLAQGLGFIFPITSSNGRAVDSIYSLIYPTNL NVFIRLTIVSVTVFVAYALIFVFNVAQNYVGIKLYQQTCATLRWKAYLKMQSMSTSFFDT QNNGDLMSRLTNDMYNIDNLFTQAGGQAIQSLFNILTTSVLIFLLSPVIALISLSILATL ITFSFAFLKKSKTSYSQVQNNLGDMSGYIEEVLTNHKVVHVLKLQEIMIKDFDQYNKSMI KPTVRGNTYSIFLFSWFGFISNITYLVSISIATAFSVNSIPSFGISVINYSFMLSYIASL RQITLALDQIFTLWNLVQLGVVSAERVFKVLDLNVEKDTATIDKLPDIKGNIRFENVAFG YNKDKPTLTGINFSVKHGDVVAIVGPTGAGKSTIINLLMKFYKPFEGKIYMDNFEISDVT KKAWREKISIVLQDSFLFSGTIKENIRLGRQDATDDEIIAACKTANAHDFIMRLPKGYDT YISNKADYLSVGERQLLTIARAVIRNAPVLLLDEATSSVDVHSEKLIQESIGRLMKNKTS FIISHRLSIIRDATLIMVINDGKVLEMGNHDQLMKQNGFYARLKQSSVR
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is MG015 and what is its functional role in Mycoplasma genitalium?

    MG015 is a putative ABC transporter ATP-binding protein found in Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195). It belongs to the ABC transporter superfamily . ABC transporters are primary active transporters found in all kingdoms of life and are involved in the transport of various substrates across membranes .

    While the specific substrates transported by MG015 are not definitively characterized, genomic analyses have identified it as a putative multidrug resistance (MDR) gene, similar to MG014 . Studies in related Mycoplasma species suggest that these proteins may be involved in antimicrobial resistance mechanisms.

    The protein consists of 589 amino acids and has a molecular mass of approximately 66.1 kDa . As an ABC transporter ATP-binding protein, MG015 likely couples ATP binding and hydrolysis with conformational changes that facilitate substrate transport across the membrane.

  • How is recombinant MG015 typically produced for research applications?

    Recombinant MG015 is typically produced using heterologous expression systems, with E. coli being the most common host organism . The production process generally involves:

    • Cloning the MG015 gene into an expression vector (often with an N-terminal His-tag for purification)

    • Transformation into an E. coli expression strain (commonly BL21-DE3)

    • Induction of protein expression

    • Cell lysis and protein extraction

    • Purification via affinity chromatography using the His-tag

    Similar to other membrane-associated proteins, MG015 can form inclusion bodies requiring denaturing conditions for solubilization . Purification protocols often include:

    • Initial purification under denaturing conditions with 6-8M urea

    • Gradual refolding through dialysis with decreasing urea concentrations

    • Final purification steps to remove misfolded protein and contaminants

    Storage recommendations typically include adding glycerol (often 50%) and storing at -20°C or -80°C to maintain stability .

  • What experimental approaches are used to study MG015 interaction with other proteins?

    Several experimental approaches can be employed to study MG015 interactions:

    • Pull-down assays: Using His-tagged recombinant MG015 to identify binding partners from cell lysates

    • Yeast two-hybrid screening: For detecting protein-protein interactions in vivo

    • Surface plasmon resonance (SPR): For measuring binding kinetics and affinity

    • Co-immunoprecipitation: To verify interactions in relevant cellular contexts

    • Crosslinking studies: To capture transient interactions

    These techniques have been applied to study ABC transporters in general and can be adapted specifically for MG015. For example, similar approaches have been used to study interactions between Mycoplasma genitalium proteins and host factors, as demonstrated in the study of MgPa interactions with host RPL35 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.