Recombinant Mycoplasma genitalium Putative phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Properties

CdsA is a transmembrane protein with nine predicted helical domains and conserved motifs (SPXKXXEG and HGGXXDRXD) critical for binding CTP and phosphatidate . Key features include:

PropertyDetails
SourceEscherichia coli-expressed recombinant protein with N-terminal His tag
Amino Acid SequenceFull-length (1-305 aa): MIWELFTNILKNKPKLSLSLTLLNAGIIIFGMIGTFVVVYFYKWNATVNGIWTLS...TSIQS
Molecular Weight~34 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); store at -20°C/-80°C

Functional Role in Bacterial Physiology

CdsA catalyzes the conversion of phosphatidic acid (PA) to CDP-DAG, a precursor for phosphatidylglycerol (PG) and cardiolipin (CL) . These phospholipids are vital for:

  • Membrane integrity: Loss of PG/CL due to cdsA mutations disrupts anionic phospholipid microdomains, impacting antimicrobial peptide resistance .

  • Antibiotic resistance: Mutations in cdsA (e.g., Asp222→Asn) reduce daptomycin (DAP) binding in Streptococcus mitis/oralis, leading to drug resistance .

  • Host-pathogen interactions: In M. genitalium, CdsA-mediated phospholipid metabolism influences adherence and invasion mechanisms linked to chronic infections .

Pathogenesis Studies

  • Inflammatory response: Recombinant CdsA indirectly modulates extracellular cyclophilin A (eCypA) secretion in human urothelial cells, activating ERK/NF-κB pathways to upregulate IL-1β, IL-6, and TNF-α .

  • Autophagy regulation: CdsA-induced eCypA suppresses apoptosis in host cells via PI3K/AKT/mTOR signaling, enhancing bacterial survival .

Antimicrobial Resistance (AMR)

  • Molecular surveillance: CdsA mutations correlate with macrolide and fluoroquinolone resistance in M. genitalium, as observed in AMR surveillance programs .

  • Membrane remodeling: Disrupted PG/CL synthesis alters membrane charge, reducing cationic antimicrobial peptide (e.g., hNP-1) efficacy .

Clinical and Epidemiological Relevance

  • STI associations: M. genitalium infections linked to pelvic inflammatory disease (PID), cervicitis, and HIV co-infections highlight CdsA’s role in virulence .

  • Diagnostic development: Recombinant CdsA fragments aid serological assays to distinguish M. genitalium from cross-reactive pathogens like M. pneumoniae .

Future Directions

  • Therapeutic targeting: Inhibitors of CdsA could combat antibiotic-resistant M. genitalium strains, which exhibit rising macrolide (≥50%) and fluoroquinolone (≥30%) resistance .

  • Structural biology: Cryo-EM studies of CdsA’s cation-binding dyad (e.g., Asp222) may elucidate substrate specificity and drug design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on your location and purchase method. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize its implementation during production.
Synonyms
cdsA; MG437; Putative phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
cdsA
Target Protein Sequence
MIWELFTNILKNKPKLSLSLTLLNAGIIIFGMIGTFVVVYFYKWNATVNGIWTLSFTLSV VLLWIIYIACMSKTRIKFSLQLSYSLGAIACFIASIGTIYFSVIRGWTTIFLLMSLAVSV DTFPFLFGKRFGKNPLIKISPSKTWEGAFFGIISTIVVVALLCVLYSIPFFVAKPTFNQT NGIALNTPQNYDSHNLITNIFLIAFISGGSSFYIYWWVSTLALIFTGSVFAIGGDLFFSY IKRLISIKDFSKVLGKHGGVLDRFDSSSFLISFFFVYHLIAGTISNQRLLMEPNTYFSAI TSIQS
Uniprot No.

Target Background

Database Links
Protein Families
CDS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of cdsA in Mycoplasma genitalium?

The putative phosphatidate cytidylyltransferase gene (cdsA) in M. genitalium exists within a highly plastic genome that demonstrates remarkable adaptation capabilities despite its minimal size. Unlike many bacterial species, M. genitalium possesses one of the smallest genomes among self-replicating organisms, with approximately 580 kilobases and around 480 protein-coding genes . The cdsA gene functions within this condensed genomic context, participating in essential phospholipid biosynthesis pathways necessary for cell membrane formation.

Understanding the genomic context is crucial for expression studies, as M. genitalium utilizes the UGA codon to encode tryptophan rather than as a stop codon (as in the standard genetic code). This alternative codon usage must be considered when expressing recombinant cdsA in heterologous systems like E. coli. Additionally, researchers should consider the AT-rich nature of the mycoplasma genome when designing primers and optimizing PCR conditions for cdsA amplification.

How does cdsA function differ between Mycoplasma genitalium and other bacterial species?

The cdsA enzyme in M. genitalium shares fundamental catalytic functions with homologs in other bacteria, but with notable differences reflecting the organism's minimalist nature. Unlike many bacterial species that possess redundant pathways for membrane phospholipid synthesis, M. genitalium relies heavily on its limited enzymatic repertoire, making cdsA potentially more essential in this organism.

M. genitalium lacks a cell wall and instead uses its plasma membrane as the primary cell boundary, which emphasizes the critical importance of phospholipid biosynthesis enzymes like cdsA. Research approaches should account for these physiological differences when comparing enzymatic activity or when using cdsA as a potential drug target. Experimental designs must consider that alterations in cdsA function may have more profound effects on M. genitalium viability compared to walled bacteria with more robust cell envelope structures .

What are the challenges in culturing Mycoplasma genitalium for cdsA studies?

Culturing M. genitalium presents significant challenges that directly impact cdsA research. The organism has exceptionally demanding growth requirements, including complex media supplemented with serum, and extremely slow growth rates (doubling time of approximately 12-16 hours) . These characteristics make traditional enzyme isolation from native cultures impractical for most research laboratories.

What are the optimal expression systems for producing active recombinant M. genitalium cdsA?

The selection of an appropriate expression system for M. genitalium cdsA requires careful consideration of several factors. E. coli-based systems remain the most commonly used, but researchers must address the UGA codon issue by either using specialized E. coli strains that suppress UGA as a stop codon or by performing site-directed mutagenesis to replace UGA codons with UGG (standard tryptophan codon).

For optimal activity, consider the following expression strategies:

Expression SystemAdvantagesLimitationsYield Optimization
E. coli BL21(DE3) with codon optimizationHigh protein yield, well-established protocolsMay require refolding, lacks post-translational modificationsLower induction temperature (16-20°C), use of fusion tags (MBP, SUMO)
Cell-free expression systemsAvoids toxicity issues, rapid productionHigher cost, lower yieldSupplementation with lipid vesicles or nanodiscs
Insect cell systemsBetter membrane protein foldingMore complex protocols, higher costOptimization of MOI, harvest time (48-72h post-infection)

Remember that cdsA is a membrane-associated enzyme, so expression conditions should be optimized to maintain proper folding and prevent aggregation. Addition of mild detergents (0.1-0.5% CHAPS or DDM) during purification often helps maintain enzymatic activity. Most successful protocols incorporate a controlled expression temperature (18-22°C) and extended expression periods to allow proper folding .

How can researchers effectively measure the enzymatic activity of recombinant cdsA?

Measuring cdsA activity requires careful consideration of the enzyme's natural substrate (phosphatidic acid) and product (CDP-diacylglycerol) within membrane environments. Several methodological approaches have proven effective:

  • Radiometric assays: Utilize [14C]CTP as a substrate and measure incorporation into CDP-diacylglycerol. This method provides high sensitivity but requires radioactive material handling capabilities.

  • HPLC-based assays: Monitor the formation of CDP-diacylglycerol directly using HPLC coupled with evaporative light scattering or mass spectrometry detection. This approach allows precise quantification without radioactivity but requires specialized equipment.

  • Coupled enzyme assays: Measure CMP release using auxiliary enzymes (nucleoside monophosphate kinase and pyruvate kinase/lactate dehydrogenase) coupled to NADH oxidation, which can be monitored spectrophotometrically.

For all assays, researchers should establish and report appropriate controls, including enzyme-free reactions and heat-inactivated enzyme preparations. Additionally, the reaction environment should mimic the native membrane context, typically using mixed micelles containing the phosphatidic acid substrate incorporated with detergents at concentrations above their critical micelle concentration .

What structural characterization techniques are most informative for recombinant M. genitalium cdsA?

Structural characterization of cdsA presents unique challenges due to its membrane association. A multi-technique approach yields the most comprehensive structural information:

  • X-ray crystallography: While challenging for membrane proteins, successful crystallization has been achieved for bacterial cdsA homologs using lipidic cubic phase methods or detergent micelles. Crystal trials should screen multiple detergents (typically DDM, LDAO, or CHAPSO) at concentrations just above CMC.

  • Cryo-electron microscopy: Increasingly valuable for membrane protein structural determination, particularly when incorporated into nanodiscs or amphipols to maintain a native-like environment.

  • Circular dichroism spectroscopy: Provides valuable information about secondary structure content and thermal stability in various detergent or lipid environments.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Offers insights into protein dynamics and solvent accessibility, particularly valuable for mapping substrate-binding regions.

  • Molecular dynamics simulations: Complement experimental data by predicting behavior in membrane environments, especially when based on homology models derived from related bacterial cdsA structures.

When reporting structural data, researchers should clearly describe the membrane mimetic environment used and account for potential detergent or lipid effects on enzyme conformation and activity .

How does cdsA function relate to M. genitalium pathogenesis?

M. genitalium pathogenesis involves complex host-pathogen interactions, with membrane components playing critical roles in adhesion, invasion, and immune modulation. As a key enzyme in phospholipid biosynthesis, cdsA indirectly contributes to pathogenesis through several mechanisms:

  • Membrane integrity maintenance: cdsA-dependent phospholipid synthesis ensures proper membrane composition necessary for mycoplasma survival within the host urogenital environment.

  • Adhesion capability: Although distinct from the primary adhesion protein (MgPa), the membrane composition influenced by cdsA activity affects the presentation and function of adhesins. Research has demonstrated that M. genitalium adhesion proteins interact with host cyclophilin A (CypA), triggering inflammatory responses through CypA-CD147 interactions and activating ERK-NF-κB signaling pathways .

  • Inflammatory response modulation: The phospholipid composition of M. genitalium membranes, regulated by cdsA activity, influences how pathogen-associated molecular patterns are recognized by host pattern recognition receptors.

Understanding these relationships requires interdisciplinary approaches combining recombinant protein studies with cell infection models. When designing such experiments, researchers should consider using both wild-type and cdsA-attenuated mycoplasma strains (if available) or reconstituting membranes with varying phospholipid compositions to assess differences in host cell interactions .

What are the most effective approaches for identifying inhibitors of M. genitalium cdsA?

Identifying effective cdsA inhibitors represents an important research direction given the rising antimicrobial resistance in M. genitalium. Current surveillance data indicates increasing macrolide resistance mutations (MRMs) in clinical isolates, highlighting the need for novel therapeutic targets . Several approaches show promise for cdsA inhibitor discovery:

  • High-throughput screening (HTS): Adapt the enzymatic assays described earlier to a microplate format suitable for screening compound libraries. Consider using fluorescence-based detection methods for increased throughput.

  • Structure-based virtual screening: Utilizing homology models or experimental structures of cdsA to computationally dock virtual compound libraries and identify potential binders for subsequent experimental validation.

  • Fragment-based screening: This approach identifies smaller chemical moieties (fragments) that bind to different regions of cdsA and can be later combined into more potent inhibitors.

  • Repurposing approaches: Testing known phospholipid biosynthesis inhibitors from other bacterial systems against M. genitalium cdsA.

When evaluating potential inhibitors, consider establishing a testing cascade that includes:

  • Primary biochemical assays for direct enzyme inhibition

  • Secondary membrane permeability assessments

  • Tertiary whole-cell activity against M. genitalium cultures

  • Quaternary cytotoxicity evaluations against human cell lines

This multi-tiered approach helps identify compounds with the most promising therapeutic potential while filtering out those with permeability or toxicity issues .

How can genetic manipulation techniques be applied to study cdsA function in M. genitalium?

  • Transposon mutagenesis: While direct disruption of essential genes like cdsA is typically lethal, transposon libraries can identify synthetic lethal interactions or genetic contexts where cdsA becomes dispensable.

  • Conditional expression systems: Implementing tetracycline-responsive or similar inducible promoters to control cdsA expression levels, allowing the study of partial depletion phenotypes.

  • Mycoplasma chromosomal transfer (MCT): A recently characterized horizontal gene transfer mechanism in mycoplasmas that allows the introduction of modified genetic material. Research has demonstrated that MCT permits the generation of mosaic genomes with donor DNA fragments incorporated into multiple loci, enabling the study of gene variants in a native context .

  • CRISPRi approaches: CRISPR interference using catalytically inactive Cas9 (dCas9) to modulate gene expression without complete knockout, particularly valuable for essential genes like cdsA.

When applying these techniques, researchers should consider the tremendous genome plasticity of mycoplasmas and their capacity for horizontal gene transfer. The MCT phenomenon, in particular, demonstrates how mycoplasma genomes can undergo dramatic reorganization, which may influence the interpretation of genetic manipulation results .

What are the best approaches for analyzing cdsA sequence variations across M. genitalium clinical isolates?

Analysis of cdsA sequence variations across clinical isolates provides valuable insights into enzyme conservation, potential functional adaptations, and suitability as a therapeutic target. Researchers should implement the following approaches:

  • Next-generation sequencing (NGS): Whole genome sequencing of clinical isolates provides comprehensive data on cdsA and its genomic context. This approach is particularly valuable given the dynamic nature of the M. genitalium genome demonstrated through horizontal gene transfer studies .

  • Targeted amplicon sequencing: PCR amplification and sequencing of the cdsA locus from multiple isolates allows for focused analysis at lower cost when whole-genome data isn't required.

  • Bioinformatic analysis pipeline:

    • Multiple sequence alignment to identify conservation patterns

    • Calculation of nucleotide diversity (π) and selection pressure (dN/dS ratios)

    • Structural mapping of variants onto protein models to predict functional impacts

    • Phylogenetic analysis to associate variants with geographical or clinical features

When interpreting sequence data, consider using clinical metadata stratification to identify potential associations between cdsA variants and factors such as antimicrobial resistance profiles, anatomical site of isolation, or clinical presentation. Surveillance studies like MyGeniUS provide important context for understanding the prevalence and distribution of M. genitalium in different populations .

How should researchers address experimental challenges in comparing recombinant versus native cdsA activity?

Comparing recombinant and native cdsA activity presents several methodological challenges that researchers must address:

  • Native enzyme isolation limitations: The difficulty in culturing sufficient quantities of M. genitalium makes direct isolation of native cdsA impractical. Instead, consider these approaches:

    • Use of gentle detergent extraction from cultured M. genitalium

    • Activity measurements in crude membrane fractions

    • Comparative activity of cdsA expressed in heterologous systems versus within M. genitalium

  • Environment reconstitution: Recombinant enzyme assays should mimic the native membrane environment as closely as possible:

    • Incorporate M. genitalium lipid extracts into proteoliposomes containing recombinant cdsA

    • Test activity across a range of pH values (typically 6.5-7.5) and divalent cation concentrations

    • Consider cholesterol inclusion, as mycoplasma membranes contain significant cholesterol unlike typical bacterial expression hosts

  • Post-translational modification consideration: Evaluate whether potential post-translational modifications affect activity by comparing:

    • Enzyme expressed in bacterial vs. eukaryotic systems

    • Mass spectrometry analysis to identify modifications

    • Site-directed mutagenesis of potential modification sites

When reporting comparative activity data, clearly state all experimental conditions and acknowledge limitations of recombinant systems. Consider that differences in activity may reflect not just the enzyme itself but its interaction with the surrounding membrane environment .

What methods are recommended for distinguishing between substrate specificity variations in cdsA across different Mycoplasma species?

Understanding substrate specificity differences in cdsA across Mycoplasma species provides valuable insights into evolutionary adaptations and may guide species-specific inhibitor development. Recommended methodological approaches include:

When reporting specificity data, present comprehensive substrate preference profiles rather than single substrate measurements. Consider using radar charts or heat maps to visualize multi-substrate preference patterns across species. These methodological approaches provide a foundation for understanding how cdsA function may have evolved differently across Mycoplasma species with varying host preferences and tissue tropisms .

What potential exists for using cdsA as a diagnostic target for M. genitalium detection?

Current M. genitalium detection methods rely primarily on nucleic acid amplification tests (NAATs), with FDA-cleared commercial assays becoming available only in recent years . The potential of cdsA as an alternative diagnostic target warrants exploration:

  • Advantages of cdsA as a diagnostic target:

    • Essential gene likely to be conserved across clinical isolates

    • Sequence divergence from human genes and other urogenital pathogens

    • Potential for multiplex detection of mycoplasma species using conserved and variable regions

  • Development pathway considerations:

    • Design and validation of cdsA-specific primers and probes

    • Comparison of analytical sensitivity and specificity against current diagnostic methods

    • Clinical validation using diverse specimen types (urine, urethral/vaginal/cervical swabs)

    • Implementation in various detection formats (PCR, isothermal amplification, CRISPR-based)

  • Integration with antimicrobial resistance detection:

    • Co-detection of cdsA with macrolide resistance mutations

    • Potential for quantitative assays to monitor treatment response

Research should assess whether cdsA-based diagnostics offer advantages over current methods targeting other genes. Additionally, consider developing multiplexed approaches that simultaneously detect M. genitalium and other urogenital pathogens, which would be valuable given the high co-infection rates observed in surveillance studies .

How might systems biology approaches enhance understanding of cdsA's role in M. genitalium?

Systems biology approaches offer powerful frameworks for understanding cdsA function within the context of M. genitalium's minimal genome:

  • Metabolic modeling applications:

    • Integrate cdsA into genome-scale metabolic models of M. genitalium

    • Perform flux balance analysis to predict the effects of cdsA modulation

    • Identify synthetic lethal interactions that could suggest combination therapy targets

  • Multi-omics integration strategies:

    • Correlate transcriptomics data on cdsA expression with lipidomics profiles

    • Analyze proteomics data to identify interaction partners and potential regulatory mechanisms

    • Use metabolomics to track phospholipid precursors and products

  • Network analysis approaches:

    • Map cdsA within the context of M. genitalium's gene regulatory networks

    • Identify hub genes that may coordinate phospholipid synthesis with other cellular processes

    • Compare network structures across different Mycoplasma species to identify conserved modules

These systems approaches are particularly valuable for M. genitalium research given its position as a model minimal organism. The relatively small number of genes and pathways makes comprehensive modeling more feasible than in more complex bacteria, potentially revealing fundamental principles about minimal requirements for cellular life .

What are the most promising strategies for studying cdsA in the context of M. genitalium persistence mechanisms?

M. genitalium infections are often persistent, and understanding how cdsA functions during persistent states represents an important research frontier:

  • In vitro persistence model development:

    • Establish nutrient limitation models that induce persistence without killing

    • Develop antibiotic-induced persistence models relevant to clinical treatment failure

    • Create host cell co-culture systems that support long-term M. genitalium survival

  • Comparative enzyme activity analysis:

    • Measure cdsA activity in actively growing versus persistent states

    • Determine if persistence involves altered substrate preferences or regulatory mechanisms

    • Evaluate whether phospholipid profiles change during persistence transitions

  • Genetic approach considerations:

    • Create conditional cdsA expression strains to determine effects on establishing or maintaining persistence

    • Use the recently characterized Mycoplasma chromosomal transfer (MCT) system to introduce variant cdsA alleles and assess their impact on persistence phenotypes

    • Apply transposon mutagenesis to identify genes that interact with cdsA during persistence

  • Therapeutic implication exploration:

    • Evaluate whether cdsA inhibitors are effective against persistent forms of M. genitalium

    • Test combination approaches targeting both cdsA and other cellular processes

These research directions address important clinical challenges, as persistent M. genitalium infections are increasingly difficult to treat due to rising antimicrobial resistance, with macrolide resistance mutations (MRMs) now common in many populations worldwide .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.