Recombinant Mycoplasma genitalium Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Potential Mechanisms

While RNase Y’s precise biological function in M. genitalium remains understudied, its homologs in other bacteria (e.g., Bacillus subtilis) suggest roles in:

  • RNA Degradation: Degrading unwanted RNA species, including non-functional mRNA or structured RNAs.

  • RNA Processing: Maturing RNA precursors (e.g., rRNA, tRNA) through 3′-end trimming.

  • RNA Homeostasis: Cooperating with transcription machinery (e.g., RNA polymerase) to regulate RNA levels .

Notably, M. genitalium’s minimal genome encodes fewer ribonucleases compared to other bacteria, implying RNase Y may have multifunctional roles .

Applications in Research and Industry

Recombinant RNase Y is primarily used as a research tool:

ApplicationDetails
SDS-PAGEUsed to verify protein purity and size (e.g., 82.9 kDa band) .
Enzyme StudiesInvestigating substrate specificity and catalytic mechanisms.
Functional AssaysAssessing interactions with RNA polymerase or other nucleases .
Structural BiologyCrystallography or cryo-EM to map RNA-binding domains (if structural data becomes available).

Comparative Insights with RNase R

While RNase Y shares a nomenclature overlap with RNase R, they are distinct enzymes:

FeatureRNase YRNase R (MgR)
Generny (MG130)rnr (MG104)
FunctionRNA degradation/processsing (putative)Degrades structured RNA, processes tRNA precursors.
SensitivityLimited dataSensitive to ribose methylation .
EssentialityNot experimentally validatedEssential in M. genitalium (gene disruption inviable) .

Research Gaps and Future Directions

  • Mechanistic Studies: No published data on RNase Y’s substrate specificity, catalytic activity, or structural interactions with RNA.

  • Evolutionary Significance: How M. genitalium’s reduced ribonuclease complement impacts RNA metabolism.

  • Industrial Applications: Potential use in biotechnology for RNA processing or diagnostic tools.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rny; MG130; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
rny
Target Protein Sequence
MNNNITNSIAQLFFNTSFFAFLFLIIIAFNLCLFAYLYFQYRIYKKNPKKANNFKANEYE KIKLLKNQNFTESNKLIATTNELNELTSQLDNILVRIINKPLAKLVNDFLDEQIKQIVKL DKNSSDFHSESDNLPFYTKLFNDFHFGVDKLININIKNPLYNWVYSPSFLISESDFRKLN GISGINKKLLVEKLRIEDIVFTDLNKKYEVNVLTESPIKAQKTVLTVRNILMNDYVDNER IESYVQQANFFFTEHCKKIGKEILESLNIFISSSSLHRHFGFLAFRYSFGQNVLSHSLET AFLTAHLAALIELDSELSLKCGLLHDIGKSNDDNGKESHTITGAKLAEQFQLPDDIKYTI ANHHNKHIDNTYCRLTQIADKLSAARIGARSDSSLLFKQLKDELKKIVDKTINNFHTTIL LGQSGRRLMIWLETKNQNQLLSNEQIIEMVEKIKAEIAKNPITNHFPIKVVIRYNFEHSF NTKS
Uniprot No.

Target Background

Function

Endoribonuclease that initiates mRNA decay.

Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Mycoplasma genitalium Ribonuclease Y and why is it significant for molecular biology research?

Mycoplasma genitalium Ribonuclease Y (MgR) is the sole identified exoribonuclease in M. genitalium, an organism with a minimal genome size. Unlike other bacteria that possess multiple exoribonucleases, M. genitalium relies exclusively on RNase Y for essential RNA degradation and processing functions. This unique feature makes MgR particularly significant as it must perform broader roles in RNA metabolism compared to its homologs in other bacteria .

The significance of MgR lies in its multifunctional nature. While Escherichia coli employs distinct enzymes like RNase R and RNase II for different aspects of RNA metabolism, MgR in M. genitalium appears to have evolved to perform both degradative and processing functions. This enzyme can degrade structured RNAs such as rRNA (like E. coli RNase R) while also possessing the ability to process tRNA 3'-ends (similar to E. coli RNase II) . Genome-wide mutagenesis studies have demonstrated that the gene encoding RNase Y cannot be interrupted, indicating the enzyme is essential for M. genitalium viability .

How does Mycoplasma genitalium RNase Y differ structurally and functionally from other bacterial ribonucleases?

Mycoplasma genitalium RNase Y (MgR) exhibits hybrid characteristics of both RNase R and RNase II from E. coli, making it functionally distinct. Key differences include:

FeatureM. genitalium RNase YE. coli RNase RE. coli RNase II
Sequence identity27% identity to both E. coli enzymesReferenceReference
Sequence similarity48% similarity to RNase R; 43% to RNase IIReferenceReference
Structured RNA degradationYes, but sensitive to ribose modificationsYes, without formation of specific productsNo, only degrades single-stranded RNA
tRNA processingEfficiently removes 3'-trailer sequenceDegrades pre-tRNA without specific productsProcesses tRNA but less efficiently
Response to 2'-O-methylationSensitive, stops 1 nucleotide downstreamNot sensitiveNot reported
Substrate specificityOligoribonucleotides, poly(A), rRNA, pre-tRNASimilar range of substratesLimited to single-stranded substrates

MgR forms specific products when degrading structured RNAs, showing sensitivity to RNA structural features that E. coli RNase R does not display. Notably, MgR stops degradation 1 nucleotide downstream of 2'-O-methylation sites in rRNA, demonstrating sensitivity to ribose modifications . This unique characteristic suggests MgR has evolved specialized recognition mechanisms for RNA processing in the minimal M. genitalium genome.

What are the recommended protocols for expressing recombinant M. genitalium RNase Y in E. coli?

Based on published methodologies, the following protocol has been successfully employed for recombinant MgR expression:

  • Cloning strategy:

    • Amplify the predicted coding sequence of the rnr gene of M. genitalium from genomic DNA (strain G37) using PCR with specific primers

    • Important consideration: Since M. genitalium uses TGA codons to encode tryptophan (while in E. coli TGA is a stop codon), these must be modified to TGG codons using site-directed mutagenesis

  • Vector construction:

    • Cleave PCR products with appropriate restriction enzymes (BspHI and BamHI reported in literature)

    • Ligate into expression vector (pET15b has been successfully used) at NcoI and BamHI sites

  • Expression system:

    • Transform plasmid into E. coli strain Rosetta-gami(DE3)/pLysS for optimal expression

    • This strain helps with codon usage differences and provides the correct folding environment

  • Expression conditions:

    • Grow cultures in LB medium at 37°C to early logarithmic phase

    • Induce with 1 mM IPTG

    • Allow expression to proceed at room temperature overnight (critical for proper folding)

  • Harvest protocol:

    • Chill cultures and harvest cells by centrifugation

    • Resuspend in an appropriate buffer (e.g., 20 mM Tris-Cl at pH 7.5, 10% glycerol, 1 mM DTT)

    • Flash-freeze using liquid nitrogen for storage at -20°C until purification

Commercial preparations are available with N-terminal His-tags that allow for efficient purification using nickel affinity chromatography .

How can researchers distinguish between the RNA degradation and RNA processing functions of M. genitalium RNase Y in experimental systems?

Distinguishing between the degradative and processing functions of M. genitalium RNase Y requires carefully designed assays that exploit the enzyme's dual functionality. Based on published research, the following methodological approach is recommended:

  • Degradation activity assessment:

    • Use structured RNA substrates (such as ribosomal RNAs) and monitor complete degradation patterns

    • Compare degradation patterns with those of E. coli RNase R, which completely degrades structured RNAs

    • Analyze degradation products using high-resolution gel electrophoresis to identify specific stopping points

  • Processing activity evaluation:

    • Employ pre-tRNA substrates with 3'-trailer sequences

    • Monitor the precise removal of the trailer sequence to generate mature 3'-ends

    • Compare processing efficiency with E. coli RNase II, which performs similar but less efficient tRNA processing

  • Sensitivity to RNA modifications:

    • Use synthetic oligoribonucleotides with site-specific 2'-O-methylation modifications

    • Analyze degradation patterns to verify if MgR stops 1 nucleotide downstream of the modification

    • This characteristic sensitivity can be used as a signature of MgR activity versus other RNases

  • RT-PCR mapping of 3'-ends:

    • For precise identification of degradation/processing endpoints, researchers should employ RT-PCR to map the 3'-ends of RNA products

    • This technique has successfully demonstrated that MgR stops at positions 2499 and 2553 of 23S rRNA, each being 1 nucleotide downstream of a 2'-O-methylation site

By comparing substrate specificity, degradation patterns, and processing efficiency between MgR, E. coli RNase R, and RNase II under identical experimental conditions, researchers can distinguish between the dual functions of this multi-purpose enzyme.

What role does RNase Y play in the pathogenesis of Mycoplasma genitalium infections?

The role of RNase Y in M. genitalium pathogenesis is not directly established in the literature, but evidence suggests several potential mechanisms through which it could contribute to virulence and persistence:

  • RNA metabolism and stress adaptation:

    • As the sole exoribonuclease in M. genitalium, RNase Y likely regulates global gene expression patterns during infection by controlling mRNA turnover

    • The enzyme's dual role in both RNA degradation and processing may allow the pathogen to rapidly adjust its gene expression profile in response to host environmental stresses

  • Potential interaction with virulence factors:

    • M. genitalium pathogenesis involves proteins like MgPa (M. genitalium protein of adhesion) that induce inflammatory responses through pathways including CypA-CD147-ERK-NF-κB

    • RNase Y could potentially regulate the expression of these and other virulence factors by controlling their mRNA stability

  • Connection to antigenic variation systems:

    • M. genitalium employs sophisticated antigenic variation mechanisms involving RecA-mediated recombination between mgpB/mgpC genes and MgPar sequences to evade host immune responses

    • While not directly involved in recombination, RNase Y may regulate the expression of genes involved in these processes

  • Essentiality for bacterial survival:

    • Gene disruption studies indicate RNase Y is essential for M. genitalium viability

    • This essentiality suggests targeting RNase Y could be a potential therapeutic approach for M. genitalium infections, which are increasingly resistant to conventional antimicrobials

The specialized RNA processing capabilities of RNase Y, combined with M. genitalium's minimal genome, suggest this enzyme plays critical roles in pathogen survival during infection that warrant further investigation for therapeutic development.

How can researchers perform comparative analyses between RNase Y from M. genitalium and its homologs in other Mycoplasma species?

To conduct rigorous comparative analyses of RNase Y from different Mycoplasma species, researchers should employ a multi-faceted approach:

  • Sequence-based phylogenetic analysis:

    • Perform multiple sequence alignments of RNase Y proteins from various Mycoplasma species

    • Identify conserved domains and species-specific variations

    • Construct phylogenetic trees to understand evolutionary relationships

    • Use tools like MEGA, PHYLIP, or MrBayes for robust phylogenetic inference

  • Structural comparison through homology modeling:

    • Generate 3D models of RNase Y homologs using available crystal structures as templates

    • Analyze conservation patterns in catalytic sites and substrate binding regions

    • Identify structural differences that might explain functional divergence

  • Heterologous expression and purification:

    • Express recombinant versions of RNase Y from different Mycoplasma species using the established E. coli expression system

    • Employ similar purification strategies (His-tag affinity chromatography) to ensure comparable preparations

    • Verify protein quality by SDS-PAGE and activity assays before comparative analyses

  • Enzymatic characterization:

    • Compare substrate preferences using defined RNA substrates

    • Determine kinetic parameters (KM, kcat) under standardized conditions

    • Analyze sensitivity to RNA modifications across different homologs

    • Assess temperature, pH, and ionic strength optima to identify species-specific adaptations

  • Cross-complementation studies:

    • Attempt complementation of RNase Y-deficient strains with homologs from other species

    • Analyze the ability of heterologous RNase Y to restore wild-type phenotypes

    • This approach could identify functional conservation or divergence between homologs

The comparative analysis could provide insights into how RNase Y has evolved in different Mycoplasma species with varying genome sizes, host ranges, and pathogenic potential.

What are the challenges and solutions for purifying active recombinant M. genitalium RNase Y?

Purifying active recombinant M. genitalium RNase Y presents several challenges, with corresponding solutions based on published methodologies:

ChallengeSolutionResearch Basis
Codon usage differencesUse specialized E. coli strains (e.g., Rosetta-gami) that supply rare tRNAs; convert TGA codons to TGGMgR contains TGA codons encoding tryptophan that must be changed to TGG for expression in E. coli
Protein folding issuesExpress at lower temperatures (room temperature) overnight rather than high-temperature short inductionOvernight induction at room temperature has been reported as successful
Potential toxicityUse tightly controlled expression systems with minimal leaky expression (pET system with T7 lysozyme)The Rosetta-gami(DE3)/pLysS strain provides controlled expression
Maintaining enzymatic activityInclude glycerol (10%) and reducing agents (DTT) in buffers to stabilize protein during purificationBuffer composition is critical for maintaining activity
Protein degradationAdd protease inhibitors during cell lysis and purification stepsNot explicitly mentioned but standard practice
Storage stabilityFlash-freeze aliquots in liquid nitrogen; avoid repeated freeze-thaw cyclesStorage at -20°C after flash-freezing preserves activity
Protein aggregationInclude 6% trehalose in storage buffer to prevent aggregationCommercial preparations use trehalose as a stabilizing agent

For reconstitution of lyophilized preparations, it is recommended to:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration for long-term storage

  • Store working aliquots at 4°C for up to one week

How does the enzymatic activity of recombinant M. genitalium RNase Y compare to native enzyme in activity assays?

  • Activity characterization protocol:

    • Use purified recombinant MgR to establish baseline enzymatic parameters

    • Employ various RNA substrates including oligoribonucleotides, poly(A), rRNA, and pre-tRNA

    • Monitor degradation patterns via gel electrophoresis and specific product formation

    • Map 3'-ends of degradation products by RT-PCR to identify characteristic stopping points

  • Native enzyme extraction considerations:

    • Limited biomass from M. genitalium cultures presents a major challenge

    • Consider using cell extracts from M. genitalium for activity comparisons

    • Normalize activities based on Western blot quantification using anti-RNase Y antibodies

  • Control experiments:

    • Include E. coli RNase R and RNase II as positive controls and reference points

    • Use specific characteristics of MgR (such as its sensitivity to 2'-O-methylation) as signatures to distinguish its activity from other potential RNases in crude extracts

  • Key parameters to compare:

    • Substrate specificity profiles

    • Kinetic parameters (KM, kcat) with model substrates

    • Sensitivity to ribose modifications

    • Efficiency of tRNA 3'-end processing

    • pH and temperature optima

The research by Zuo and Deutscher demonstrated that purified recombinant MgR exhibits the expected characteristics of both degrading structured RNA (like RNase R) and processing pre-tRNA (like RNase II), suggesting the recombinant enzyme maintains functional properties anticipated for the native protein .

What are the optimal buffer conditions and experimental parameters for in vitro RNase Y activity assays?

Based on published research methodologies, the following conditions are recommended for optimal M. genitalium RNase Y activity assays:

Buffer Components and Reaction Conditions:

ParameterOptimal ConditionNotes
Buffer composition20 mM Tris-HCl (pH 7.5)Standard buffer used for RNase activity assays
Salt concentration100 mM KClProvides ionic strength without inhibiting activity
Divalent cations5 mM MgCl₂Essential for ribonuclease activity
Reducing agent1 mM DTTMaintains enzyme stability and activity
pH range7.0-7.5Optimal for maintaining enzyme structure and function
Temperature30-37°CBalance between enzyme activity and substrate stability
Reaction time10-60 minutesDepends on substrate and analysis method
Enzyme concentration10-100 nMTitrate to achieve linear reaction kinetics
RNA substrate concentration0.1-1 μMUse purified, defined RNA substrates

Recommended RNA Substrates:

  • Synthetic oligoribonucleotides (with or without 2'-O-methylation modifications)

  • Poly(A) RNA for homopolymer degradation assays

  • Purified ribosomal RNA (16S and 23S rRNA)

  • Pre-tRNA substrates with 3'-trailer sequences for processing activity

Analysis Methods:

  • Denaturing polyacrylamide gel electrophoresis for degradation pattern analysis

  • RT-PCR mapping of 3'-ends for precise product identification

  • HPLC or capillary electrophoresis for quantitative analysis of degradation products

  • Fluorescence-based assays for real-time monitoring of activity

Control Experiments:

  • Include E. coli RNase R and RNase II as reference enzymes

  • Use RNase inhibitors (e.g., RNasin) as negative controls

  • Heat-inactivated enzyme control

  • EDTA control to demonstrate divalent cation requirement

These conditions provide a starting point for establishing robust RNase Y activity assays, but researchers should optimize parameters for their specific experimental setup and research questions .

How can researchers investigate the potential role of RNase Y in Mycoplasma genitalium pathogenesis?

Investigating the role of RNase Y in M. genitalium pathogenesis requires a multidisciplinary approach spanning molecular genetics, cell biology, and infection models. The following research strategy is recommended:

  • Conditional expression systems:

    • Since RNase Y is essential , traditional knockout approaches are not viable

    • Develop conditional expression systems using tetracycline-responsive promoters or CRISPRi

    • Create strains with tunable RNase Y levels to study partial depletion phenotypes

  • Point mutation studies:

    • Generate catalytic site mutations to create enzymatically inactive variants

    • Express these variants in M. genitalium to study dominant-negative effects

    • Examine changes in global RNA metabolism and stability

  • Transcriptome analysis:

    • Compare RNA profiles between wild-type and RNase Y-depleted strains

    • Identify transcripts directly affected by RNase Y activity

    • Focus on known or putative virulence genes like MgPa (adhesion protein)

    • Use RNA-seq to identify RNase Y-dependent changes in gene expression

  • Cell culture infection models:

    • Use urethral epithelial cell lines (SV-HUC-1) to study host-pathogen interactions

    • Compare adhesion, invasion, and inflammatory responses between wild-type and RNase Y-modulated strains

    • Measure cytokine responses (IL-1β, IL-6, TNF-α) using qRT-PCR and ELISA

  • Investigation of potential interactions with recombination systems:

    • Analyze whether RNase Y affects expression of RecA, which mediates antigenic variation

    • Study possible roles in regulating mgpB/mgpC phase and antigenic variation

    • Determine if RNase Y influences recombination frequencies between expression sites and MgPar regions

  • RNA metabolism during infection:

    • Examine if RNase Y activity changes under different host conditions

    • Investigate post-translational modifications that might regulate RNase Y during infection

    • Study RNase Y localization during different stages of host cell interaction

  • Therapeutic targeting evaluation:

    • Screen for small molecule inhibitors of RNase Y

    • Test effects of identified inhibitors on M. genitalium growth and virulence

    • Assess combination effects with existing antimicrobials given increasing resistance concerns

This comprehensive approach would provide insights into how RNase Y contributes to M. genitalium pathogenesis and potential avenues for therapeutic intervention.

What genome engineering approaches can be used to study RNase Y function in Mycoplasma genitalium?

  • Heterologous recombination systems:

    • The RecET-like system from Bacillus subtilis has been successfully used for gene manipulation in related mycoplasmas

    • This system enables targeted replacement and inactivation of genes through homologous recombination

    • For studying RNase Y, researchers could:

      • Replace the native rny gene with tagged versions for localization studies

      • Introduce point mutations to study structure-function relationships

      • Create transcriptional fusions to measure expression levels

  • Conditional expression strategies:

    • Since direct knockout of rny would be lethal, conditional approaches are necessary

    • Implement inducible promoter systems upstream of the rny gene

    • Use antisense RNA or CRISPRi approaches to achieve tunable repression

    • Establish a complementation system where an inducible copy of rny is present while the native copy is targeted

  • Cre-lox recombination system:

    • The Cre recombinase system has been demonstrated to function in mycoplasmas

    • This allows for marker removal after initial gene modifications

    • Create a strain with loxP sites flanking rny along with an inducible backup copy

    • Upon Cre expression, the native rny would be excised, allowing functional studies of variants

  • RAGE method adaptation:

    • The Recombinase-Assisted Genome Engineering (RAGE) method uses Cre-mediated cassette exchange

    • This approach has successfully introduced large fragments (15-38 kbp) in Mycoplasma pneumoniae

    • Could be adapted to replace the rny genomic region with modified versions

  • Suppressor mutation screening:

    • If conditional depletion of RNase Y is achieved, screen for spontaneous mutations that alleviate growth defects

    • Similar to studies in B. subtilis where RNase Y deficiency was suppressed by mutations affecting RNA polymerase

    • Such suppressors might reveal functional interactions and regulatory networks

  • Homologous gene complementation:

    • Test whether RNase Y homologs from other species can complement M. genitalium RNase Y

    • Express RNase Y from other mycoplasmas or even from B. subtilis under control of native M. genitalium promoters

    • This approach could identify conserved and species-specific functions

Implementation of these strategies must account for M. genitalium's distinctive genetic code, where TGA encodes tryptophan rather than acting as a stop codon as in E. coli .

How does RNase Y cooperate with other RNA processing enzymes in the minimal genome of M. genitalium?

In the minimal genome of M. genitalium, RNase Y likely serves as a central hub for RNA metabolism, collaborating with the limited complement of other RNA processing enzymes. Although specific interactions are not fully characterized in the available literature, we can draw inferences based on known RNA processing pathways and the M. genitalium genome content:

  • RNA degradosome-like complexes:

    • In organisms with larger genomes, RNase enzymes often form complexes called degradosomes

    • M. genitalium lacks many components of traditional degradosomes but may form simplified complexes

    • Potential interactions between RNase Y and helicases or other processing factors warrant investigation

  • Coordination with ribosomes:

    • The connection between translation and RNA degradation is likely preserved even in minimal genomes

    • RNase Y may interact with ribosomal proteins or translation factors to coordinate mRNA turnover

    • Studies could examine co-localization or co-immunoprecipitation of RNase Y with ribosomal components

  • Interplay with RNA polymerase:

    • Research in B. subtilis indicates tight cooperation between RNase Y and RNA polymerase

    • Suppressor mutations affecting RNA polymerase alleviated defects caused by RNase Y deletion

    • This suggests a critical balance between RNA synthesis and degradation for optimal cellular function

    • Similar coordination may exist in M. genitalium, potentially more pronounced due to its minimal genome

  • Function in RNA repair:

    • M. genitalium has a limited repertoire of DNA repair enzymes, including RecA and UvrC

    • RNase Y may participate in RNA quality control by removing damaged RNA molecules

    • This function would be particularly important given the organism's limited redundancy in repair pathways

  • Processing of structured RNAs:

    • RNase Y's dual capability to process both structured RNAs and pre-tRNAs suggests it works at the interface of different RNA processing pathways

    • For tRNA maturation, RNase Y may coordinate with other enzymes involved in 5' processing or nucleotide modification

  • Regulation of stress responses:

    • RNase Y likely plays a role in regulating gene expression during stress conditions

    • Its activity may be modulated through interactions with stress-responsive proteins

    • This would allow rapid adaptation despite the limited genome

The unique positioning of RNase Y as the sole identified exoribonuclease in M. genitalium highlights its central importance in RNA metabolism. Its dual functionality in both degradation and processing suggests it has evolved expanded capabilities to compensate for the reduced complement of RNA-processing enzymes in this minimal genome .

How can recombinant M. genitalium RNase Y be used to study the impact of ribose modifications on RNA processing?

Recombinant M. genitalium RNase Y (MgR) offers a unique experimental tool for studying ribose modifications due to its documented sensitivity to 2'-O-methylation . Researchers can exploit this property through the following methodological approaches:

  • Mapping unknown modification sites:

    • Treat natural RNA samples with MgR and analyze degradation endpoints

    • Identify stopping points 1 nucleotide downstream of potential modifications

    • Confirm modifications through alternative methods like mass spectrometry

    • This provides a novel enzyme-based method to detect certain RNA modifications

  • Structural impact studies:

    • Compare degradation patterns of unmodified versus modified RNA constructs

    • Design synthetic oligoribonucleotides with specific modifications at defined positions

    • Analyze how different types of ribose modifications (2'-O-methyl, pseudouridine, etc.) affect MgR activity

    • Determine the structural basis for modification recognition through enzyme kinetics

  • Comparative analysis protocol:

    • Create a panel of RNA substrates with identical sequences but varying modification patterns

    • Perform parallel degradation assays with MgR, E. coli RNase R, and RNase II

    • Analyze degradation products using high-resolution gel electrophoresis or MS/MS techniques

    • This approach can reveal modification-specific effects on different RNases

  • Methylation pattern profiling in different bacterial species:

    • Use MgR as a probe to detect methylation patterns in bacterial RNAs

    • Compare methylation landscapes between pathogenic and non-pathogenic bacteria

    • Investigate changes in methylation under different growth conditions or stresses

  • Evolutionary insights:

    • Study whether sensitivity to modifications is conserved among RNase Y homologs

    • Investigate if this property relates to the minimal genome of M. genitalium

    • Explore whether modification sensitivity evolved as an RNA quality control mechanism

Experimental Design Framework:

StepProcedureAnalytical Method
1Prepare synthetic RNA substrates with defined modificationsChemical synthesis or in vitro transcription with modified nucleotides
2Treat with recombinant MgR under standardized conditionsEnzyme assay in optimal buffer
3Map degradation endpointsRT-PCR, primer extension, RNA-seq
4Quantify degradation efficiencyGel electrophoresis, phosphorimaging
5Compare with control RNasesParallel assays with E. coli RNase R and RNase II
6Analyze structural requirementsVary modification positions and types

The demonstrated sensitivity of MgR to 2'-O-methylation provides researchers with a novel enzymatic tool to probe RNA modifications, offering insights into both fundamental RNA biology and the specialized functions of RNase Y in minimal bacterial genomes .

What considerations are important when using recombinant RNase Y for in vitro RNA structure probing studies?

When employing recombinant M. genitalium RNase Y for RNA structure probing, several critical considerations ensure robust and interpretable results:

  • Enzyme preparation quality:

    • Verify enzyme homogeneity by SDS-PAGE (>90% purity recommended)

    • Confirm enzymatic activity using standard substrates before structure probing

    • Use fresh enzyme preparations or aliquots that have not undergone multiple freeze-thaw cycles

    • Consider the impact of affinity tags (e.g., His-tag) on enzyme behavior

  • RNA substrate considerations:

    • Ensure RNA is completely denatured and properly refolded before assays

    • Remove contaminating RNases from RNA preparations by DEPC treatment or commercial RNase inhibitors

    • Consider both in vitro transcribed and native RNA substrates for comparative analyses

    • Account for the impact of 5' and 3' extensions on RNA folding

  • Reaction conditions optimization:

    • Titrate enzyme concentration to achieve partial digestion (typically 10-100 nM)

    • Optimize reaction time to capture intermediates before complete degradation

    • Ensure buffer components (particularly Mg²⁺ concentration) support both enzyme activity and RNA structure

    • Control temperature precisely to maintain RNA structure during digestion

  • Controls and reference standards:

    • Include known structured and unstructured RNA controls

    • Compare MgR digestion patterns with those generated by RNase R and RNase II

    • Perform parallel structure probing using chemical probes (DMS, SHAPE reagents) for validation

    • Include no-enzyme controls to identify spontaneous RNA degradation

  • Accounting for specific MgR characteristics:

    • Consider the enzyme's sensitivity to 2'-O-methylation when interpreting results

    • Be aware that MgR may form specific products from structured RNA substrates

    • Expect different digestion patterns compared to other RNases due to MgR's unique properties

  • Analysis methods:

    • Use high-resolution sequencing gels for precise mapping of cleavage sites

    • Consider RNA-seq approaches for genome-wide structure probing

    • Apply RT-PCR methods to map 3'-ends of degradation products

    • Implement computational tools to integrate structure probing data with predicted RNA structures

  • Interpretation challenges:

    • Distinguish between stops due to RNA structure versus RNA modifications

    • Consider competitive binding between different structured elements in complex RNAs

    • Account for potential protein contaminants that might influence RNA structure or enzyme activity

By carefully addressing these considerations, researchers can leverage the unique properties of M. genitalium RNase Y for valuable insights into RNA structure, particularly in systems where sensitivity to specific RNA modifications is of interest.

How might RNase Y function be exploited for developing novel antimicrobial strategies against Mycoplasma genitalium?

The essential nature of RNase Y in M. genitalium positions it as a promising target for novel antimicrobial development, particularly important given the rising antimicrobial resistance in this pathogen . Several strategic approaches could be pursued:

  • Target validation and druggability assessment:

    • Confirm essentiality through conditional expression systems

    • Identify the minimum level of RNase Y activity required for viability

    • Map the active site and potential allosteric regulatory sites

    • Assess conservation across mycoplasma species versus divergence from human ribonucleases

  • High-throughput screening approaches:

    • Develop fluorescence-based assays for RNase Y activity using quenched fluorescent RNA substrates

    • Screen chemical libraries for small molecule inhibitors

    • Employ fragment-based drug discovery to identify chemical scaffolds that bind to RNase Y

    • Virtual screening against the modeled structure of M. genitalium RNase Y

  • Rational drug design strategies:

    • Solve the crystal structure of recombinant RNase Y or develop accurate homology models

    • Design transition-state analogs that inhibit the catalytic mechanism

    • Target unique structural features distinguishing MgR from host ribonucleases

    • Focus on the enzyme's sensitivity to RNA modifications as a potential exploitation point

  • Peptide inhibitor development:

    • Identify potential protein-protein interaction surfaces on RNase Y

    • Design peptides that mimic natural binding partners

    • Use phage display or similar technologies to screen for high-affinity peptide binders

    • Develop cell-penetrating peptide conjugates for delivery into mycoplasmas

  • Antisense approaches:

    • Design antisense oligonucleotides targeting the rny mRNA

    • Optimize delivery systems for oligonucleotide entry into mycoplasma cells

    • Consider peptide nucleic acids (PNAs) for enhanced stability and cell penetration

  • Combination therapy potential:

    • Test RNase Y inhibitors in combination with existing antimicrobials

    • Explore synergistic effects with macrolides and fluoroquinolones, common treatments for M. genitalium

    • Investigate whether RNase Y inhibition sensitizes resistant strains to conventional antibiotics

  • Specificity considerations:

    • Ensure selectivity against bacterial versus human ribonucleases

    • Assess activity against other bacterial species to determine spectrum of action

    • Evaluate potential for resistance development through target modification

  • Delivery systems for minimal genome bacteria:

    • Develop lipid-based delivery systems targeting the unique membrane composition of mycoplasmas

    • Exploit the lack of cell wall in mycoplasmas for direct membrane penetration

    • Consider conjugation to adhesion proteins for targeted delivery to mycoplasma cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.