Recombinant Mycoplasma genitalium Uncharacterized protein MG076 (MG076)

Shipped with Ice Packs
In Stock

Description

Introduction to MG076

MG076 is a predicted uncharacterized protein encoded by the Mycoplasma genitalium genome. As an uncharacterized protein, its functional role, subcellular localization, and interaction with host cells remain undefined in the scientific literature. The term "recombinant" indicates that MG076 has been expressed in heterologous systems (e.g., E. coli) for experimental purposes, though no published studies explicitly describe its cloning, expression, or functional analysis.

Reasons for Absence of Data

  1. Prioritization of High-Impact Proteins: Research has focused on surface-exposed proteins (e.g., MgPa, MG075) due to their roles in pathogenesis and diagnostics.

  2. Genome Complexity: M. genitalium has a minimal genome (~580 kb), but uncharacterized proteins may lack obvious homologs or motifs for functional prediction.

  3. Technical Challenges: Recombinant expression of hydrophobic or insoluble proteins (common in Mycoplasma) often requires advanced engineering .

Potential Research Directions

While MG076 remains understudied, its characterization could address critical questions:

AreaMethodologyHypothesis
Functional AnnotationBioinformatics (BLAST, Pfam), CRISPRi screeningIdentifying conserved domains or metabolic roles (e.g., lipid metabolism, stress response).
Subcellular LocalizationFluorescence microscopy, proteomicsDetermining whether MG076 is cytoplasmic, membrane-bound, or secreted.
Host InteractionPhage-display libraries, co-IPInvestigating binding to host proteins (e.g., RPL35, cyclophilin A) .

Comparative Context with Related Proteins

MG076’s uncharacterized status aligns with challenges in studying M. genitalium’s minimal genome. For example:

  • MG075: Despite low expression, its N-terminal fragment (MG075F1) serves as a serological marker due to high conservation and low cross-reactivity with M. pneumoniae .

  • MG427: Demonstrated hydroperoxide reductase activity, highlighting the importance of functional studies for uncharacterized proteins .

Implications for MG076

  • Structural Prediction: Homology modeling could identify potential enzymatic or binding motifs.

  • Antigenic Potential: If surface-exposed, MG076 might evade host immunity or serve as a diagnostic target.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MG076; Uncharacterized protein MG076
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG076
Target Protein Sequence
MVLNQNKNSNKAEYGGIVVSVFYLILFFLILNITIYFHKSTNFTVVVKNSVLTSFFVNLL LVCLQGIFRLKTCDGMRYEISKFNRYLKLGSVYAKPLVSFNQYQDQSATYRQKTSGFWWM NLIVYLVGSLVSGLVSLL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant MG076 be stored to maintain stability?

Optimal storage of recombinant MG076 requires:

  • Storage at -20°C/-80°C upon receipt

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for long-term storage

The protein's hydrophobic nature necessitates careful handling, as repeated freezing and thawing is not recommended and can lead to protein denaturation and aggregation.

What expression systems are most effective for producing recombinant MG076?

E. coli expression systems have been successfully used to produce recombinant MG076, typically with an N-terminal His tag to facilitate purification . The expression construct generally includes:

ComponentDetails
Expression VectorpET vector system or equivalent
TagN-terminal His tag
HostE. coli BL21(DE3) or similar expression strains
Protein FormTypically produced as lyophilized powder
Purity>90% as determined by SDS-PAGE

When designing expression constructs, researchers should consider codon optimization for E. coli, as mycoplasma species use alternative genetic codes (e.g., TGA codes for tryptophan in mycoplasmas but functions as a stop codon in E. coli) .

What experimental approaches are recommended for characterizing the structure of MG076?

For structural characterization of MG076, a multi-faceted approach is recommended:

  • Computational prediction: Ab initio protein structure prediction methods such as TOUCHSTONE have been applied to Mycoplasma genitalium proteins with varying success . Similar approaches could provide initial structural insights for MG076.

  • Experimental validation: Techniques should include:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Nuclear Magnetic Resonance (NMR) spectroscopy for solution structure

    • X-ray crystallography (if crystals can be obtained)

    • Cryo-electron microscopy for membrane-embedded contexts

  • Comparative analysis: Structural comparison with proteins of known function from related organisms can provide functional clues.

The success of structural characterization will depend on protein purity, stability, and handling of the hydrophobic regions that may cause aggregation.

How can researchers validate the purity and integrity of recombinant MG076 preparations?

A comprehensive validation approach for recombinant MG076 should include:

Validation MethodPurposeAcceptance Criteria
SDS-PAGEAssess protein size and puritySingle band at expected MW (~15-16 kDa + tag size); >90% purity
Western BlotConfirm identityPositive signal with anti-His antibody
Mass SpectrometryVerify sequence integrityPeptide coverage >80%; correct mass
Dynamic Light ScatteringAssess aggregation stateMonodisperse population
Circular DichroismSecondary structure integrityConsistent spectrum between batches

When working with hydrophobic proteins like MG076, maintaining denaturing conditions during SDS-PAGE is crucial. The addition of 6–8 M urea to the loading buffer may be necessary prior to gel electrophoresis if the protein has been stored at −20°C after purification .

What experimental design considerations are important when studying potential interactions of MG076 with other proteins?

When designing experiments to study MG076 interactions:

  • Bait preparation: Recombinant MG076 should be properly folded or in a native-like membrane environment.

  • Pull-down assays: Consider using:

    • His-tag pull-down from bacterial lysates

    • Crosslinking approaches for transient interactions

    • Membrane-based pull-downs for context-appropriate interactions

  • Controls:

    • Include negative controls (unrelated proteins with similar tags)

    • Use denaturing conditions as negative controls

    • Include positive controls if known interactors exist

  • Analysis methods:

    • Mass spectrometry for protein identification

    • Western blotting for specific candidate interactors

    • Functional assays to validate biological relevance of interactions

  • Experimental design structure:

    • Define variables clearly (independent: interaction conditions; dependent: binding partners)

    • Control for extraneous variables (pH, salt concentration, detergents)

    • Use appropriate statistical analysis for results validation

What methodological approaches can be used to investigate the potential role of MG076 in Mycoplasma genitalium pathogenesis?

A comprehensive investigation into MG076's role in pathogenesis requires a multi-layered experimental design:

  • Gene expression analysis:

    • Compare MG076 expression levels between pathogenic and non-pathogenic strains

    • Assess expression changes during infection using qRT-PCR

    • Analyze transcriptomic data across different infection stages

  • Gene knockout/knockdown studies:

    • Generate MG076 deletion mutants if genetic manipulation is possible

    • Assess impact on bacterial viability, growth, and infection capability

    • Complement mutants to confirm phenotype specificity

  • Host-pathogen interaction assays:

    • Investigate adhesion to host cells with and without functional MG076

    • Assess impact on host cell inflammatory responses

    • Evaluate contribution to immune evasion mechanisms

  • Serological approaches:

    • Develop assays to detect antibodies against MG076 in patient samples

    • Compare antibody responses between different patient groups

    • Assess correlation between anti-MG076 antibodies and disease severity

Each approach should follow rigorous experimental design principles, including appropriate controls, statistical power calculations, and blinding where applicable .

How can computational methods aid in predicting the function of uncharacterized proteins like MG076?

Computational prediction of MG076 function can employ these methodological approaches:

  • Sequence-based analysis:

    • Homology detection using sensitive methods like HMMER or PSI-BLAST

    • Motif identification using PROSITE, PFAM, or similar databases

    • Secondary structure prediction with PSIPRED or JPred

  • Structure-based prediction:

    • Ab initio modeling using methods like TOUCHSTONE or AlphaFold

    • Structure comparison with known protein folds using DALI or VAST

    • Active site prediction using CASTp or similar tools

  • Genomic context analysis:

    • Examination of gene neighborhood conservation

    • Phylogenetic profiling across bacterial species

    • Co-expression pattern analysis

  • Integration of multiple evidence types:

    • Weighted scoring of different prediction methods

    • Machine learning approaches combining multiple features

    • Network-based function prediction using protein-protein interaction data

For Mycoplasma genitalium proteins, structure prediction has shown variable success. Based on studies of other M. genitalium proteins, better results correlate with higher numbers of contact restraints (>137% relative to protein length) and fewer clustering results (<5 clusters) .

How can serological assays be developed to detect antibodies against MG076 in clinical samples?

Development of a serological assay for MG076 antibody detection requires addressing several methodological challenges:

  • Antigen preparation:

    • Express recombinant MG076 with optimal solubility and native conformation

    • Consider using protein fragments if full-length protein is problematic

    • Improve solubility through protein engineering if necessary

  • Assay format selection:

    • Immunoblot assays offer good specificity but lower throughput

    • ELISA provides quantitative results and higher throughput

    • Bead-based multiplex assays allow simultaneous testing of multiple antigens

  • Cross-reactivity management:

    • Address cross-reactivity with M. pneumoniae, a closely related respiratory pathogen

    • Validate with sera from children (unlikely to have M. genitalium exposure) with and without M. pneumoniae infection

    • Include controls from PCR-confirmed M. genitalium positive and negative individuals

  • Performance assessment:

    • Determine sensitivity using samples from PCR-confirmed M. genitalium infections

    • Establish specificity using appropriate negative control samples

    • Assess reproducibility across different laboratories

What are the best practices for designing experiments to characterize potentially membrane-associated proteins like MG076?

Characterizing membrane-associated proteins like MG076 requires specialized experimental approaches:

  • Membrane localization confirmation:

    • Fractionation studies comparing membrane vs. cytosolic fractions

    • Protease protection assays to determine topology

    • Fluorescence microscopy with tagged constructs to visualize localization

  • Detergent selection for solubilization:

    • Screen multiple detergents (e.g., DDM, LDAO, OG)

    • Assess protein stability in each detergent using thermal shift assays

    • Optimize detergent concentration for maximal extraction with minimal denaturation

  • Alternative solubilization approaches:

    • Nanodiscs or lipid bicelles for native-like membrane environment

    • Amphipols for stabilizing membrane proteins in solution

    • SMALPs (styrene maleic acid lipid particles) for extraction with native lipids

  • Functional characterization in membrane context:

    • Reconstitution into liposomes for functional assays

    • Planar lipid bilayer electrophysiology if channel/transport function is suspected

    • Binding assays in membrane environment if receptor function is hypothesized

The experimental design should include appropriate controls and account for the challenges inherent to membrane protein research, such as maintaining structural integrity outside the native membrane environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.