Recombinant Mycoplasma genitalium Uncharacterized protein MG133 (MG133)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MG133; Uncharacterized protein MG133
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG133
Target Protein Sequence
MKKSIGIFYRCFYLNNKCDYYLIFLAPFSLFTQIFMVITALISVANSGQMSLIWFTNFDT FTYQSNSLAIFLVWYYFLNHKSRWFENSSLVLSVTGYLVFTVIFFNFYALSRFTGIVNIE PDVQGWFSTITTQLPYSFNGSFINDWNAFSELLLHVIHPLFYFIYVGLLFKTYKFIKPPR NLQSFLLKAGIYPSIYAFYLQTIPFLNVWDNGENSYSVYGFFTQTKYNSYVWIWSIPIFA SMFLILWMLFVINNHYYGKKHHK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma genitalium Uncharacterized Protein MG133?

MG133 is a hypothetical protein from Mycoplasma genitalium that has been predicted to be expressed from an open reading frame but whose structure and function have not been fully characterized experimentally. Like other hypothetical proteins (HPs), it represents part of the substantial fraction of proteomes in both prokaryotes and eukaryotes that remain functionally undefined . Understanding MG133 could provide insights into M. genitalium's pathogenicity mechanisms, survival strategies, and host-pathogen interactions.

Why study uncharacterized proteins like MG133 from Mycoplasma genitalium?

Uncharacterized proteins like MG133 are studied because they may play crucial roles in bacterial pathogenesis and survival. Genome projects have led to the identification of many potential therapeutic targets, putative protein functions, and interaction networks . For pathogenic organisms like M. genitalium, these proteins could be involved in adhesion to host cells, immune evasion, or cellular manipulation similar to the characterized MgPa protein . Additionally, novel proteins may reveal new structural motifs or functional mechanisms that expand our understanding of protein biology and potentially serve as markers or pharmacological targets.

What computational approaches should I use for initial characterization of MG133?

Initial computational characterization should employ multiple bioinformatic methods:

  • Sequence homology analysis using tools like BLAST to identify potential functional homologs

  • Motif discovery using the MEME suite to identify conserved domains or functional regions

  • Secondary and tertiary structure prediction through homology modeling or ab initio approaches

  • Subcellular localization prediction to determine potential cellular function

  • Protein-protein interaction prediction using databases like STRING

These computational methods provide hypotheses about function that can direct subsequent experimental validation and characterization efforts.

What expression systems are optimal for producing recombinant MG133 protein?

Based on successful approaches for other M. genitalium proteins like MgPa , recommended expression systems include:

  • E. coli expression systems: Using vectors with T7 promoters similar to those used for producing soluble recombinant MgPa (rMgPa)

  • Mammalian cell expression: Especially if post-translational modifications are critical

  • Cell-free expression systems: For proteins that may be toxic to host cells

The optimal expression strategy must consider:

  • Codon optimization for the host organism

  • Inclusion of purification tags (His, GST, MBP) for downstream purification

  • Expression conditions that minimize inclusion body formation

  • Fusion partners that may enhance solubility

How can I verify successful expression and purification of recombinant MG133?

Verification requires multiple analytical techniques as described in the literature for protein characterization :

Verification MethodPurposeTechnical Approach
SDS-PAGEMolecular weight and purity assessmentSeparates proteins according to molecular weight; compare with marker proteins
Western BlottingConfirmation of protein identityUsing antibodies against tags or the protein itself
Mass SpectrometryDefinitive identificationPeptide mass fingerprinting matches experimentally obtained masses to theoretical peptide masses
Circular DichroismSecondary structure verificationConfirms proper protein folding
Dynamic Light ScatteringHomogeneity assessmentDetects protein aggregation

Mass spectrometry is particularly powerful as it provides high-throughput analysis and permits characterization of putative gene products at the level of translation. The mass spectrum serves as a unique "fingerprint" for the protein, confirming its identity when matched against database entries .

What protein-protein interaction methods should I use to identify MG133 binding partners?

Building on successful approaches for M. genitalium adhesion proteins , employ these methods:

  • T7 phage-displayed cDNA library screening: Similar to the technique used for identifying RPL35 as an MgPa interacting protein, construct a T7 phage-displayed human cell cDNA library to screen potential MG133 binding partners

  • Far-Western blotting: Validate direct protein interactions in vitro by using purified recombinant MG133 as a probe against cellular lysates

  • Co-immunoprecipitation: Pull down protein complexes from cells exposed to MG133

  • Microfluidics platforms: Advanced microfluidics large scale integration (mLSI) technology allows for parallel testing of multiple protein interactions, enabling high-throughput screening

  • Co-localization analysis: Confirm intracellular interactions through fluorescence microscopy with labeled proteins

How should I handle contradictory data when characterizing MG133?

Contradictory data is common in protein characterization studies and requires systematic handling:

  • Identify types of contradictions in your dataset:

    • Different output values for the same input conditions

    • Same output values for different input conditions

  • Quantify the extent of contradictions:

    • Calculate the percentage of observations with contradictions (in published datasets, contradictions have been observed in up to 35.34% of observations)

    • Determine if contradictions exceed measurement error thresholds

  • Apply appropriate data preprocessing:

    • Remove clear outliers while preserving genuinely contradictory data

    • Consider discretization of continuous variables where appropriate

    • Document all preprocessing decisions transparently

  • Select modeling approaches that handle contradictions:

    • Decision trees algorithm (DT)

    • Rough sets algorithm (RST)

What are best practices for presenting MG133 research findings?

For effective presentation of research findings on MG133, follow these guidelines:

  • Tables and figures must be self-explanatory and understood without referring to the main text. Include clear titles, labels, and informative formatting .

  • Choose the appropriate format based on data type:

    • Tables for precise numerical values and structured data

    • Figures for visualizing trends and relationships

    • Text for describing complex interactions

  • Maintain consistency between data presented in tables/figures and information in the main text .

  • Avoid clutter by including only relevant data in tables and figures. Organize information clearly using appropriate spacing, labels, and legends .

  • Follow journal-specific guidelines regarding preparation, formatting, and placement of tables and figures .

Presentation FormatBest Used ForLimitations
TablesPrecise numerical values, structured data, exact comparisonsLess effective for visualizing trends
FiguresTrends, patterns, relationships, visual impactMay not convey exact values
TextComplex relationships, significance discussionLimited visual impact

How can I determine if MG133 affects cellular processes like the MgPa protein does?

To assess MG133's effects on cellular processes, employ methodologies similar to those used for MgPa:

  • MTT assays to evaluate effects on cell proliferation, as demonstrated for MgPa-RPL35 interaction

  • Transfection studies with expression vectors containing MG133 (similar to pcDNA3.1(+)/MgPa)

  • Temporal analysis of effects at different time points (24, 36, 48, 72 hours post-transfection)

  • Quantitative proteomics (e.g., TMT protein quantitative analysis) to examine changes in protein expression profiles following MG133 interaction with host proteins

  • Statistical validation of results using appropriate controls and replicates

The interaction between MgPa and RPL35 was shown to promote cell proliferation at early stages of M. genitalium infection . Similar methodologies can determine if MG133 has comparable effects or different impacts on host cellular processes.

How can I determine the structural features of MG133 if traditional crystallography fails?

When traditional crystallography proves challenging for proteins like MG133, employ these alternative approaches:

What functional genomics approaches can help determine MG133's role in M. genitalium biology?

To elucidate MG133's functional role, consider these advanced genomics approaches:

  • Gene knockout or knockdown studies: Create MG133-deficient strains through CRISPR-Cas systems adapted for Mycoplasma or transposon mutagenesis

  • Transcriptomics analysis: Compare gene expression profiles between wild-type and MG133-deficient strains under various conditions

  • Comparative genomics: Analyze conservation of MG133 across Mycoplasma species and related organisms to infer functional importance

  • Protein-protein interaction networks: Generate comprehensive interaction maps to place MG133 in biological pathways

  • Phenotypic screening: Assess changes in growth, morphology, stress responses, and virulence in MG133-modified strains

Remember that hypothetical proteins help in understanding the biological systems through system-wide studies of proteins and their interactions with other proteins and non-proteinaceous molecules that control complex processes in cells .

How can I use mass spectrometry to comprehensively characterize MG133?

Mass spectrometry offers powerful approaches for characterizing uncharacterized proteins like MG133:

  • Peptide mass fingerprinting: Identify MG133 by matching experimentally obtained peptide masses with theoretical peptide masses generated from a protein database. The mass spectrum serves as a unique "fingerprint" for the protein .

  • Tandem MS (MS-MS): For more definitive identification, especially with larger genomes where peptide mass fingerprinting alone may be insufficient .

  • Post-translational modification (PTM) mapping: Identify and localize modifications that may be crucial for protein function.

  • Top-down proteomics: Analyze the intact protein to capture the full complement of proteoforms.

  • Crosslinking mass spectrometry (XL-MS): Capture protein-protein interactions and protein conformational information.

  • MALDI-MS or ESI-MS: For accurate mass determination and verification of recombinant protein integrity .

Mass spectrometry is particularly valuable for validating protein coding genes, as it analyzes and quantifies thousands of proteins from complex samples and permits the characterization of putative gene products at the level of translation .

How can contradictory experimental results about MG133 function be reconciled?

When facing contradictory experimental results in MG133 characterization:

  • Identify the nature of contradictions:

    • Different values of the output variable for the same input variables

    • Same value of the output variable for different values of input variables

  • Quantitative assessment:

    • Calculate the percentage of contradictory observations (published datasets show contradictions in up to 35.34% of observations)

    • Determine if differences exceed measurement error thresholds

  • Data validation approaches:

    • Test different discretization criteria for continuous variables

    • Apply rule-based modeling methods like decision trees or rough sets algorithms that can handle contradictory data

    • Perform chi-square tests to evaluate variable independence (as demonstrated in published studies with test statistic values of 639.3)

  • Reconciliation strategies:

    • Replication with standardized protocols

    • Meta-analysis of multiple datasets

    • Identification of hidden variables affecting outcomes

    • Development of more complex models incorporating contradictions as biologically meaningful variance

The paper referenced in search result demonstrates that the number of inconsistent observations depends on the adopted data discretization criteria, highlighting the importance of data preparation in handling contradictory results.

What cutting-edge approaches can reveal MG133's role in host-pathogen interactions?

To investigate MG133's potential role in host-pathogen interactions:

  • Single-cell interaction studies: Examine MG133's effects on individual host cells using microfluidics-based approaches

  • CRISPR screening in host cells: Identify host factors required for MG133-mediated effects

  • Organoid infection models: Test MG133's role in more physiologically relevant tissue models

  • Spatial transcriptomics/proteomics: Map the spatial distribution of host responses to MG133 exposure

  • Live-cell imaging with fluorescently tagged MG133: Track protein localization and dynamics during host cell interaction

  • Functional screening using T7 phage-displayed cDNA libraries: Similar to approaches used for identifying MgPa interactions with host RPL35 protein

As demonstrated with MgPa protein, bacterial proteins can interact with host components (like RPL35) to promote cellular processes such as proliferation, potentially contributing to pathogenesis at early infection stages . Similar mechanisms might be discovered for MG133.

What antibody development approaches are most effective for studying uncharacterized proteins like MG133?

For developing antibodies against uncharacterized proteins:

  • Epitope prediction and peptide synthesis: Use computational tools to identify likely antigenic regions of MG133

  • Recombinant protein immunization: Express and purify full-length or domain-specific constructs as immunogens

  • Phage display technology: Generate recombinant antibodies without animal immunization

  • Monoclonal vs. polyclonal strategies: Consider applications requirements (specificity vs. multiple epitope recognition)

  • Validation requirements:

    • Western blotting against recombinant protein and native M. genitalium lysates

    • Immunoprecipitation of native and recombinant proteins

    • Immunofluorescence microscopy to confirm localization

    • Blocking studies to confirm functional relevance

How can I optimize experimental conditions for studying MG133-host protein interactions?

To optimize protein-protein interaction studies:

  • Buffer optimization: Screen multiple buffer conditions for stability and interaction strength:

Buffer ComponentRange to TestRationale
pH6.0-8.0Affects protein charge and conformation
Salt (NaCl)50-300 mMModulates electrostatic interactions
Detergents0.01-0.1%Reduces non-specific interactions
Reducing agents0-5 mM DTTMaintains cysteine residues
Protein concentration0.1-10 μMDetermines interaction saturation
  • Temperature and incubation time: Test interactions at physiologically relevant conditions (37°C) versus standard conditions (4°C, room temperature)

  • Detection methods: Compare direct labeling, antibody-based detection, and label-free approaches

  • Control experiments: Include proper negative controls (non-interacting proteins) and positive controls (known interacting pairs)

  • Validation approaches: Confirm interactions using multiple methods such as those employed for MgPa-RPL35 interaction: far-Western blotting, co-location analysis, and functional assays

Successful strategies have been demonstrated in characterizing interactions between M. genitalium adhesion proteins and host factors, revealing functional consequences such as enhanced cell proliferation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.