Recombinant Mycoplasma genitalium Uncharacterized protein MG220 (MG220)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

MG220 is primarily produced in E. coli using inducible promoter systems (e.g., T7, lac, tac) . Alternative expression hosts include yeast, baculovirus, mammalian cells, and cell-free systems, though E. coli remains the most common due to cost-effectiveness .

Host SystemAdvantagesLimitations
E. coliHigh yield, low cost, His-tag compatibility for Ni-NTA chromatography Potential inclusion body formation
YeastProper eukaryotic post-translational modifications (e.g., glycosylation)Lower yield compared to E. coli
Baculovirus/Mammalian CellsNative folding and disulfide bondsHigh production costs

Diagnostic and Serological Studies

MG220 is used in ELISA kits for detecting anti-Mycoplasma genitalium antibodies, though its specificity remains under investigation . Unlike MG075 (a validated serological marker for M. genitalium), MG220’s cross-reactivity with Mycoplasma pneumoniae is unconfirmed .

Challenges and Considerations

  1. Uncharacterized Function: MG220’s biological role in M. genitalium remains undefined, limiting its utility in mechanistic studies.

  2. Solubility Issues: Hydrophobic regions may necessitate denaturing conditions (e.g., urea) for proper handling .

  3. Strain Variability: While MG075 exhibits low variability, MG220’s antigenic stability across M. genitalium strains is unverified .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MG220; Uncharacterized protein MG220
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG220
Target Protein Sequence
MWLIDKRSYMYKLEKAQAKQVVGGLSFWTFSAGLIMIVNALTGVAHAVNDIFQSTTANAN GSDDDNENKNNSYRSKSNYFNTARFKLGLTPGSSSYSFPVFS
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_220

Subcellular Location
Cell membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.