Recombinant Mycoplasma genitalium Uncharacterized protein MG255 (MG255)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MG255; Uncharacterized protein MG255
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG255
Target Protein Sequence
MESENQIAILDYIFNQVNQPNQPKIVWFSGEGEDEKINFLIRLNDFFKPKFVENTNDSSF LLSFRNHVETKNSTPLTQANFANIANKLLAVLFGSLQWKQLNKPTGNWFLVILFLALLWL RQCWLKLQLTKISKFVNQKGILSFIKQQWPILTTLVTVGTTLGTPVFSLTIAQQDGIKQN AGNDVFIFLIIFSVFSISLGLVSSLIFLVSSLFSIRQKKTLDALDKVLSKFIDKYFFLDE KEIKKQLKYQFKNNGVCFFYGFDFDQAEFLEQSMNLMLLLKQTNCFILVGCKESEMTLIK NKIEPNINLKQNSFYLDLSNEISQVEQISKFNLLFRQLRLSSELFYLEDFFDYLTTAKQI VNFLF
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_255

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma genitalium Uncharacterized protein MG255?

MG255 is a 365-amino acid protein (P47497) from Mycoplasma genitalium, a pathogenic bacterium that colonizes the human urogenital tract. Despite being identified in the minimal genome of M. genitalium during its sequencing, the function of MG255 remains largely unknown, hence its "uncharacterized" designation . The protein has a molecular weight of approximately 42.4 kDa and is encoded by the MG255 gene . Research suggests it may be membrane-associated, potentially playing a role in host-pathogen interactions during infection .

How is recombinant MG255 protein expressed and purified for research purposes?

Methodological Answer:

Recombinant MG255 is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The following protocol summarizes the standard approach:

  • Expression System Selection: E. coli BL21(DE3) strain is commonly used due to its high expression efficiency and reduced protease activity .

  • Vector Construction:

    • The MG255 gene is PCR-amplified from M. genitalium genomic DNA

    • The amplicon is cloned into an expression vector (typically pET series) with an N-terminal His-tag

    • Sequence verification ensures integrity of the construct

  • Expression Conditions:

    • Transformed E. coli cultures are grown to mid-log phase (OD600 = 0.6-0.8)

    • Induction with IPTG (typically 0.5-1.0 mM)

    • Expression at lower temperatures (16-25°C) for 16-18 hours to enhance solubility

  • Purification Strategy:

    • Cell lysis using sonication or high-pressure homogenization in Tris/PBS-based buffer (pH 8.0)

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin

    • Elution with imidazole gradient (50-250 mM)

    • Further purification with size exclusion chromatography if higher purity is required

  • Storage:

    • The purified protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquoted and stored at -20°C/-80°C to avoid repeated freeze-thaw cycles

    • Addition of 5-50% glycerol improves stability during storage

Purification StepConditionsExpected Outcome
Cell LysisTris/PBS-based buffer, pH 8.0Crude cell extract
IMACNi-NTA resin, 50-250 mM imidazole gradient>90% purity
Size ExclusionSuperdex 200 column>95% purity
Final ProductLyophilized powder or solution with 6% trehaloseStable protein for research applications

What experimental designs are most effective for studying potential functions of MG255?

Methodological Answer:

Since MG255 is uncharacterized, a multi-faceted experimental approach is recommended:

Experimental DesignApplicationAdvantagesLimitations
XL-MSProtein interaction identificationCaptures transient interactionsRequires specialized equipment
Cofractionation MSComplex identificationValidates stable interactionsMay miss weak interactions
Randomized Block DesignComparative studiesControls experimental variabilityRequires homogeneous blocks
Latin Square DesignMulti-factor experimentsEfficient use of resourcesIncomplete factorial design

How can structure prediction tools be validated when studying an uncharacterized protein like MG255?

Methodological Answer:

For uncharacterized proteins like MG255, structure prediction requires a multi-step validation approach:

  • Multiple Algorithm Comparison:

    • Deploy several prediction tools (AlphaFold2, RoseTTAFold, I-TASSER)

    • Compare the structural models for consensus regions

    • Areas of agreement across methods suggest higher confidence

  • Model Quality Assessment:

    • Evaluate global metrics: QMEANDisCo, MolProbity scores

    • Check Ramachandran plot distributions for stereochemical quality

    • Analyze predicted Local Distance Difference Test (pLDDT) scores from AlphaFold2

    • Establish confidence thresholds (e.g., pLDDT >70 for reliable regions)

  • Experimental Validation Strategies:

    • Limited proteolysis to verify domain boundaries

    • Circular dichroism to confirm secondary structure composition

    • Cross-validate with low-resolution experimental data (SAXS)

    • Site-directed mutagenesis of predicted functional residues

  • Functional Region Annotation:

    • Map sequence conservation onto the structural model

    • Identify potential binding pockets using computational tools

    • Correlate hydrophobic regions with predicted transmembrane domains

    • Compare functional predictions with known proteins of similar fold

This validation framework ensures that structural predictions are robustly assessed before being used to guide further experimental work on MG255.

What are the critical considerations when designing antibody-based detection methods for MG255 protein?

Methodological Answer:

Developing antibody-based detection for MG255 requires careful consideration due to potential cross-reactivity and the presence of M protein (MG281), a universal antibody-binding protein in M. genitalium . The following methodological framework is recommended:

  • Epitope Selection:

    • Perform in silico epitope prediction to identify unique regions of MG255

    • Avoid hydrophobic segments that may be membrane-embedded

    • Target regions with high predicted surface accessibility

    • Consider generating antibodies against multiple epitopes

  • Antibody Production Strategy:

    • Use synthetic peptides or recombinant protein fragments as immunogens

    • Employ both polyclonal and monoclonal approaches

    • Screen hybridoma supernatants against whole cell lysates to identify cross-reactivity

    • Include rigorous negative controls with other Mycoplasma species

  • Cross-Reactivity Mitigation:

    • Pre-absorb antibodies with M. genitalium MG281 (protein M) to reduce non-specific binding

    • Implement epitope-specific purification to isolate target-specific antibodies

    • Validate specificity using knockout/knockdown controls if available

    • Test against human tissue samples to check for cross-reactivity with host proteins

  • Detection Method Optimization:

    • Establish optimal antibody concentrations through titration

    • Determine appropriate blocking conditions to minimize background

    • Verify signal-to-noise ratios in relevant sample matrices

    • Compare detection limits across multiple methods (Western blot, ELISA, IHC)

Validation ParameterAcceptance CriteriaRecommended Controls
SpecificityNo signal in negative controlsOther Mycoplasma species, host tissue
SensitivityDetection limit ≤10 ng proteinRecombinant protein dilution series
ReproducibilityCV <15% across replicatesPositive controls at high/med/low concentrations
Cross-reactivity<5% signal with non-target proteinsPanel of related proteins

How might MG255 protein studies inform therapeutic approaches for Mycoplasma genitalium infections?

Methodological Answer:

Investigating MG255 as a potential therapeutic target requires a systematic approach that connects basic research to clinical applications:

  • Target Validation Process:

    • Determine protein essentiality through conditional knockout or CRISPRi approaches

    • Assess conservation across clinical isolates to predict resistance potential

    • Evaluate expression levels during different infection stages

    • Correlate expression with virulence in clinical samples

  • Therapeutic Strategy Development:

    • If membrane-associated, consider accessibility for antibody-based therapeutics

    • For enzymatic functions, design small molecule inhibitor screening campaigns

    • Evaluate potential for vaccine development if immunogenic

    • Consider combination approaches targeting multiple M. genitalium proteins

  • Resistance Mechanism Assessment:

    • Current M. genitalium treatments face increasing antibiotic resistance

    • Azithromycin-resistant infections have been reported across multiple continents

    • Moxifloxacin remains effective but resistance is emerging

    • Novel targets like MG255 could provide alternatives to conventional antibiotics

  • Clinical Translation Considerations:

    • Design proof-of-concept trials modeled after successful protocols

    • Consider phase 2a trials with surrogate endpoints (bacterial load reduction)

    • Implement randomized placebo-controlled designs for definitive efficacy testing

    • Determine appropriate dosing schedules based on pharmacodynamic studies

Research on MG255 is particularly relevant given that azithromycin-resistant M. genitalium infections are increasing, with treatment success rates declining from 85% to around 60% in recent years .

What role might MG255 play in Mycoplasma genitalium pathogenesis based on current research?

Methodological Answer:

While the specific function of MG255 remains uncharacterized, several research approaches can elucidate its potential role in pathogenesis:

  • Comparative Genomics Analysis:

    • MG255 is conserved in a minimal genome (M. genitalium has only 525 genes)

    • Conservation suggests functional importance in the organism's lifecycle

    • Comparative analysis with other mycoplasma species can identify unique features

    • Synteny analysis may reveal functional associations with known virulence factors

  • Expression Pattern Profiling:

    • Quantify MG255 expression during different growth phases

    • Compare expression levels between laboratory strains and clinical isolates

    • Analyze expression changes during host cell attachment and infection

    • Correlate expression with clinical manifestations (urethritis, cervicitis)

  • Host Response Studies:

    • Assess host immune recognition of MG255

    • Measure inflammatory cytokine responses to purified MG255

    • Evaluate interaction with pattern recognition receptors

    • Determine if antibodies against MG255 are present in infected individuals

M. genitalium infections are associated with urethritis in men and potentially cervicitis, pelvic inflammatory disease, and infertility in women . The ability of M. genitalium to establish persistent infections despite the host immune response suggests important virulence mechanisms that may involve uncharacterized proteins like MG255.

What statistical approaches are most appropriate for analyzing protein-protein interaction data involving MG255?

Methodological Answer:

Protein-protein interaction (PPI) studies with uncharacterized proteins like MG255 present unique analytical challenges requiring specialized statistical approaches:

  • Interaction Scoring Methods:

    • Implement probabilistic scoring frameworks that account for both direct and indirect interactions

    • Calculate interaction confidence scores based on spectral counts or intensity values

    • Apply appropriate normalization to account for protein abundance variations

    • Use supervised machine learning to classify true versus false positive interactions

  • Network Analysis Approaches:

    • Construct protein interaction networks with weighted edges based on confidence scores

    • Identify protein complexes using clustering algorithms (MCL, MCODE)

    • Calculate network centrality measures to identify key nodes

    • Compare to random networks to assess significance of observed patterns

  • Differential Interaction Analysis:

    • Compare interaction profiles across different conditions

    • Apply statistical tests with multiple testing correction

    • Calculate fold-changes and significance values for each interaction

    • Visualize using volcano plots or heat maps

  • Validation Strategy:

    • Implement a multi-stage validation process for discovered interactions

    • Primary screen: crosslinking MS (XL-MS)

    • Secondary validation: co-fractionation MS

    • Tertiary confirmation: targeted pulldown experiments

    • Final verification: functional assays specific to the interaction

Analysis MethodApplicationMetricsSignificance Threshold
Probabilistic ScoringInitial PPI identificationFDR, p-valueFDR <0.05
Network AnalysisSystem-level understandingModularity, centralityp<0.01 vs random networks
Differential AnalysisCondition-specific interactionsLog2FC, adjusted p-value|Log2FC|>1, p<0.05
Co-elution ProfileComplex validationCorrelation coefficientPearson r>0.7

How should researchers design experiments to differentiate between the functions of MG255 and other uncharacterized proteins in Mycoplasma genitalium?

Methodological Answer:

Distinguishing the functions of uncharacterized proteins requires a systematic experimental design strategy:

The choice of experimental design should be guided by the specific research question, the number of proteins being compared, known sources of variation, and available resources.

Design TypeBlock StructureReplication StrategyAnalysis MethodBest For
CRDNo blocksEach protein tested multiple timesOne-way ANOVAInitial screening
RBDSingle blocking factorComplete blocksTwo-way ANOVAControlled comparisons
FactorialTreatments are combinationsReplicate each combinationMulti-factor ANOVAInteraction effects
Latin SquareTwo blocking factorsEach treatment appears once in each row/columnThree-way ANOVAResource-limited studies

How can researchers address reproducibility challenges when working with recombinant MG255 protein?

Methodological Answer:

Reproducibility in recombinant protein research is critical. For MG255, implement these methodological safeguards:

  • Expression System Standardization:

    • Document complete strain genotype and growth conditions

    • Use chemically defined media when possible

    • Maintain consistent induction parameters (timing, temperature, inducer concentration)

    • Control cell density at induction (OD600 = 0.6-0.8)

  • Purification Protocol Optimization:

    • Validate buffer compositions with stability studies

    • Determine optimal pH range for protein stability

    • Establish quality control checkpoints at each purification step

    • Implement precise fraction collection based on UV absorbance profiles

  • Batch Validation Procedures:

    • Measure protein concentration using multiple methods (Bradford, BCA, A280)

    • Verify purity by SDS-PAGE (>90% homogeneity)

    • Confirm identity by mass spectrometry

    • Assess folding state using circular dichroism or fluorescence spectroscopy

    • Test activity/function using established assays

  • Storage and Stability Controls:

    • Determine optimal storage conditions (buffer, temperature, additives)

    • Add 6% trehalose to improve stability during lyophilization

    • Avoid repeated freeze-thaw cycles

    • Add 5-50% glycerol for long-term storage at -20°C/-80°C

    • Monitor stability over time with activity assays

  • Reporting Standards:

    • Document complete methods according to established guidelines

    • Report all quality control metrics in publications

    • Share detailed protocols through repositories

    • Maintain consistent lot numbering and tracking

Implementing these practices will significantly improve reproducibility across different research groups working with MG255 and other recombinant proteins.

What emerging technologies might accelerate functional characterization of uncharacterized proteins like MG255?

Methodological Answer:

Several cutting-edge technologies show promise for elucidating the functions of uncharacterized proteins:

  • AI-Assisted Structural Proteomics:

    • Deep learning approaches like AlphaFold2 can predict protein structures with near-experimental accuracy

    • These predictions can guide targeted experiments

    • Structural information enables function prediction through fold recognition

    • Combined with evolutionary analysis, can identify potential functional sites

  • Single-Cell Protein Analysis:

    • New methods allow protein detection at single-cell resolution

    • Can reveal heterogeneity in protein expression during infection

    • Enables correlation of protein levels with cellular phenotypes

    • Particularly valuable for studying host-pathogen interactions

  • Proximity Labeling Techniques:

    • APEX2, BioID, or TurboID can map protein neighborhoods in living cells

    • These approaches identify spatial relationships without requiring stable interactions

    • Can reveal membrane protein associations that are difficult to capture with traditional methods

    • Particularly relevant for membrane-associated proteins like MG255

  • CRISPR Interference/Activation Screens:

    • CRISPRi/CRISPRa systems allow modulation of gene expression

    • Enables genome-wide functional screening

    • Can reveal genetic interactions and functional relationships

    • May identify pathways involving uncharacterized proteins

  • Advanced Mass Spectrometry:

    • Hydrogen-deuterium exchange MS reveals protein dynamics

    • Cross-linking MS identifies protein-protein interaction interfaces

    • Native MS preserves protein complexes for structural analysis

    • These techniques provide complementary structural and functional insights

The integration of these emerging technologies with traditional biochemical and genetic approaches offers the most promising path forward for understanding uncharacterized proteins like MG255.

How might research on MG255 contribute to understanding the minimal genome concept in synthetic biology?

Methodological Answer:

M. genitalium, with only 525 genes for the canonical G37 strain, represents one of the smallest known cellular genomes and serves as a model for minimal genome research . MG255, as an uncharacterized protein retained in this minimal genome, holds particular significance:

  • Essential Gene Identification Framework:

    • Determine if MG255 is essential through targeted disruption

    • Implement conditional expression systems to study depletion phenotypes

    • Connect essentiality to specific cellular processes

    • Contribute to the catalog of minimal essential genes

  • Functional Redundancy Assessment:

    • Investigate whether MG255 has functionally redundant partners

    • Perform synthetic lethality screens with other genes

    • Study compensatory mechanisms when MG255 is depleted

    • Use this knowledge to refine minimal genome models

  • Cross-Species Complementation Studies:

    • Express MG255 in other bacterial species lacking homologs

    • Assess functional conservation across evolutionary distance

    • Identify minimal functional domains through truncation studies

    • Determine if function is context-dependent or autonomous

  • Synthetic Biology Applications:

    • Incorporate MG255 into minimal synthetic genomes

    • Assess performance in artificial cell systems

    • Explore potential for biocontainment strategies

    • Contribute to design principles for minimal synthetic cells

The knowledge gained from studying MG255 can inform key questions in synthetic biology regarding the minimum set of genes required for cellular life and the functions that must be maintained even in highly reduced genomes.

What are the most significant knowledge gaps regarding MG255 that researchers should prioritize addressing?

Current knowledge gaps that warrant priority research include:

  • Structural characterization - Despite sequence information, the three-dimensional structure remains unknown, limiting structure-function analyses.

  • Subcellular localization - Experimental verification of the predicted membrane association is needed to understand its biological context.

  • Interaction partners - While crosslinking MS approaches show promise , the specific protein-protein interaction network of MG255 remains largely undefined.

  • Temporal expression patterns - Understanding when and under what conditions MG255 is expressed during infection cycles could provide functional insights.

  • Clinical relevance - The potential relationship between MG255 and pathogenesis, antibiotic resistance, or immune evasion requires investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.