Recombinant Mycoplasma genitalium Uncharacterized protein MG256 (MG256)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MG256; Uncharacterized protein MG256
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG256
Target Protein Sequence
MHFNSNFKECFNKIAKKVNSLDSEYYEFSSFIERIRTTFGLLIALTVLSNLIIISFVLIW FFTDGFGQLRLLFFTLFIPFFISLLVAIFLIFLNNSFRNFFQINEKNWLFLWTCVFSSLP IFNLWLIVRLNKTIKNFASDYGFKIVNKYNSLTSGIFVFDFADYVSFEANLTNWKNTNDK NRNFVNFFETISKEKTGVVQKPVLNFQRLYVNRLYYQSKLSVGSNQQTPQTAFDNLRNYV ENKQRETVRVKQYILT
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_256

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant MG256 protein?

E. coli expression systems have been successfully used to produce recombinant MG256 protein with N-terminal His tags. This approach offers several advantages for research applications, including:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yield, well-established protocols, cost-effectivePotential improper folding of membrane proteins, inclusion body formationLower expression temperature (16-25°C), specialized E. coli strains (e.g., BL21(DE3)pLysS), solubility-enhancing fusion tags
Insect cellsBetter post-translational modifications, improved foldingHigher cost, longer production timeBaculovirus expression vector systems, optimization of MOI
Mammalian cellsNative-like folding and modificationsHighest cost, complex protocolsTransient vs. stable expression systems, codon optimization

For most biochemical and initial characterization studies, the E. coli expression system with His-tagging provides sufficient quantity and purity of MG256. The recombinant protein is typically provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage is recommended .

What methods are recommended for functional annotation of uncharacterized proteins like MG256?

Functional annotation of uncharacterized proteins like MG256 requires a multi-faceted approach combining computational prediction and experimental validation:

  • Computational Prediction Methods:

    • Domain identification using InterProScan, Motif, SMART, HMMER, and NCBI CDART

    • Homology detection using BlastP against well-characterized proteins

    • String analysis to identify functional protein partners

    • Structural prediction using tools like AlphaFold or RoseTTAFold

  • Experimental Validation Methods:

    • Protein-protein interaction studies (pull-down assays, yeast two-hybrid)

    • Subcellular localization using fluorescent tagging

    • Functional assays based on predicted activities

    • Knockout/knockdown studies to observe phenotypic effects

Research has shown that combining these approaches significantly increases the accuracy of functional predictions. For example, in studies of other uncharacterized proteins, functions were successfully assigned to proteins when conserved domains were predicted by two or more databases, providing high confidence annotations .

How can Design of Experiments (DoE) be applied to optimize purification and characterization of MG256?

Design of Experiments (DoE) approaches offer powerful strategies for optimizing MG256 protein purification and characterization by systematically exploring multiple factors simultaneously. A full factorial or central composite face-centered (CCF) design can be particularly effective:

  • Full Factorial Design for Initial Screening:

    • Identify key factors affecting MG256 purification (pH, salt concentration, temperature)

    • Create an experimental matrix exploring all combinations of factor levels

    • Analyze main effects and interaction effects

  • Central Composite Face-Centered Design for Response Surface Modeling:

    • Follow up with CCF design to detect quadratic effects

    • Develop predictive models of protein behavior

    • Identify optimal conditions for maximum yield and purity

The evaluation of DoE data requires statistical analysis including:

  • ANOVA tables to assess statistical significance

  • Residual analysis to validate model assumptions

  • Response surface visualization to identify optimal conditions

For example, in a dynamic binding capacity optimization study shown in search result7, researchers discovered that linear models were insufficient due to significant quadratic effects, demonstrating the importance of proper experimental design for protein characterization7. For MG256, optimizing conditions for solubility, stability, and activity would be critical objectives of a DoE approach.

What insights can structural analysis provide about MG256's potential function in M. genitalium pathogenesis?

Structural analysis of MG256 can provide crucial insights into its potential function in M. genitalium pathogenesis, particularly given the bacterium's limited genome size (2.17 Mb) and streamlined functionality. Advanced structural analysis approaches include:

  • Predictive Structural Analysis:

    • Secondary structure prediction indicates MG256 contains multiple hydrophobic segments consistent with transmembrane domains

    • Computational topology modeling suggests a membrane protein with potential exposure to both intracellular and extracellular environments

  • Experimental Structural Determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-EM for structural determination without crystallization

    • NMR spectroscopy for dynamic structural information

  • Structural Homology Analysis:

    • Comparison with structurally characterized proteins may reveal functional similarities

    • Identification of conserved structural motifs across related species

These approaches may reveal whether MG256 participates in M. genitalium's sophisticated mechanisms for immune evasion, host cell attachment, or invasion. The bacterium's "stealth" pathogen characteristics and its ability to persist despite immune responses make understanding the potential structural contributions of MG256 to these processes particularly valuable .

How might MG256 contribute to M. genitalium's gene regulation and antigenic variation mechanisms?

While MG256's specific role in gene regulation and antigenic variation remains uncharacterized, research on M. genitalium's molecular pathogenesis provides context for investigating potential functions:

  • Potential Roles in Gene Regulation:

    • M. genitalium has limited regulatory genes, with key regulators like MG428 (a sigma factor) controlling expression of recombination genes

    • MG256 might function as part of regulatory networks, potentially interacting with known regulators

    • Structural features suggest possible membrane localization, which could indicate a role in signal transduction

  • Connections to Antigenic Variation:

    • M. genitalium employs sophisticated recombination mechanisms (mgpBC/MgPar recombination) for antigenic and phase variation

    • Recombination is tightly regulated in M. genitalium despite its minimal genome

    • MG256 could participate in pathways that influence recombination frequency or specificity

  • Experimental Approaches to Test These Hypotheses:

    • Protein-protein interaction studies with known regulatory proteins like MG428

    • ChIP-seq to identify potential DNA binding sites

    • Gene knockout/knockdown to observe effects on recombination rates and antigenic variation

Understanding whether MG256 contributes to M. genitalium's unique regulatory systems would provide valuable insights into how this minimal organism navigates diverse host environments and evades immune responses despite its limited genetic repertoire .

What are the recommended protocols for studying protein-protein interactions involving MG256?

Investigating protein-protein interactions (PPIs) involving MG256 requires multiple complementary approaches to overcome challenges associated with uncharacterized proteins:

  • Affinity-Based Methods:

    • Pull-down assays using His-tagged MG256 as bait

    • Co-immunoprecipitation with antibodies against predicted interaction partners

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

  • Proximity-Based Methods:

    • Bacterial two-hybrid systems adapted for mycoplasmas

    • Bimolecular fluorescence complementation (BiFC)

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • Global Interactome Analysis:

    • String database analysis to predict functional partners based on genomic context

    • Correlation of expression patterns with known M. genitalium proteins

    • Computational prediction of interaction sites based on structural features

A systematic workflow should begin with computational prediction of potential interaction partners, followed by in vitro validation using multiple techniques, and ultimately confirmation in more physiologically relevant systems. For MG256, particular attention should be paid to interactions with proteins involved in host-cell attachment, immune evasion, or gene regulation mechanisms .

How can researchers develop an effective experimental design to study MG256's role in M. genitalium infection models?

Developing effective experimental designs for studying MG256's role in M. genitalium infection models requires addressing the unique challenges presented by this fastidious organism:

  • Cell Culture Models:

    • Establish reproducible infection of human epithelial cell lines

    • Compare wild-type M. genitalium with MG256 knockout/knockdown strains

    • Measure endpoints including adhesion efficiency, intracellular survival, host cell responses

  • Factorial Experimental Design:

    FactorLevelsMeasured Responses
    Bacterial strainWild-type, ΔMG256, complemented strainAttachment efficiency, invasion rate, inflammatory markers
    Infection time24h, 48h, 72hHost cell viability, bacterial persistence
    Host cell typeCervical, urethral epithelial cellsCell-specific responses
  • Controls and Validation:

    • Include complementation studies to confirm phenotype specificity

    • Implement time-course analyses to capture dynamic processes

    • Use multiple experimental replicates and appropriate statistical analysis

  • Advanced Endpoints:

    • Transcriptomic analysis of host and bacterial responses

    • Confocal microscopy for spatial localization of MG256 during infection

    • Measurement of antigenic variation rates

The experimental design should accommodate the slow growth of M. genitalium and the potential subtlety of phenotypes resulting from manipulation of a single uncharacterized protein. Appropriate statistical power calculations should be performed to ensure sufficient sample sizes for detecting meaningful differences .

What are the most effective computational approaches for predicting MG256 function based on limited data?

Predicting the function of uncharacterized proteins like MG256 from limited data requires sophisticated computational approaches that integrate diverse information sources:

  • Sequence-Based Prediction:

    • Sensitive homology detection using PSI-BLAST and HHpred

    • Identification of conserved motifs even with remote sequence similarity

    • Analysis of physicochemical properties and compositional bias

  • Structure-Based Prediction:

    • Ab initio structure prediction using AlphaFold or similar tools

    • Structure-based function prediction through comparison with functional sites

    • Molecular dynamics simulations to identify potential binding pockets

  • Genomic Context-Based Approaches:

    • Gene neighborhood analysis across mycoplasma species

    • Co-expression network construction from available transcriptomic data

    • Phylogenetic profiling to identify co-evolving genes

  • Machine Learning Integration:

    • Developing ensemble models that combine multiple predictive features

    • Using active learning approaches as demonstrated in the GeneDisco benchmark

    • Implementing Bayesian optimization for experimental design

When applied to MG256, these approaches should consider the protein's potential membrane localization and the minimal genomic context of M. genitalium. The analysis should be iterative, with computational predictions informing targeted experiments that then refine future predictions .

How can researchers address the challenges of antimicrobial resistance when studying M. genitalium proteins like MG256?

Addressing antimicrobial resistance in the context of studying M. genitalium proteins like MG256 presents unique research challenges that require specialized approaches:

  • Understanding Resistance Mechanisms:

    • Investigate whether MG256 contributes to intrinsic or acquired resistance

    • Examine potential roles in membrane permeability or drug efflux

    • Study protein-antibiotic interactions through molecular modeling

  • Experimental Approaches:

    • Compare MG256 expression levels in susceptible versus resistant strains

    • Develop recombinant expression systems for testing resistance hypotheses

    • Implement site-directed mutagenesis to identify critical residues

  • Clinical Relevance:

    • M. genitalium is increasingly showing resistance to multiple antibiotics, requiring 10-day antibiotic courses

    • Studying MG256 could reveal novel drug targets or resistance mechanisms

    • Correlate findings with clinical treatment outcomes

Researchers must consider that M. genitalium requires specific growth conditions and is difficult to culture, making traditional antimicrobial susceptibility testing challenging. Alternative approaches such as molecular assays for resistance determinants and recombinant expression of specific proteins like MG256 may provide more accessible ways to study resistance mechanisms .

What are the most promising applications of MG256 research in vaccine development and diagnostic tools?

Research on MG256 has potential applications in both vaccine development and diagnostic tools for M. genitalium infections:

  • Vaccine Development Potential:

    • If MG256 is confirmed to be surface-exposed, it could represent a vaccine target

    • Advantages include potential conservation across strains compared to variable antigens

    • Challenges include determining immunogenicity and protective efficacy

  • Diagnostic Applications:

    • Development of serological assays targeting antibodies against MG256

    • Potential for improved specificity compared to current diagnostic methods

    • Applications in monitoring treatment success and epidemiological studies

  • Research Roadmap:

    PhaseObjectivesKey Methods
    1. CharacterizationDetermine cellular localization and immunogenicityImmunofluorescence, epitope mapping
    2. Diagnostic DevelopmentAssess specificity and sensitivity as biomarkerSerological assays, ROC analysis
    3. Vaccine ResearchEvaluate protective potentialAnimal models, immune response analysis

The development of these applications must consider the challenges in studying M. genitalium, including its fastidious nature and the fact that it often presents without symptoms. The characterization of MG256 could contribute to addressing the ongoing public health challenges posed by this pathogen, particularly as antimicrobial resistance increases .

How can integrative multi-omics approaches advance our understanding of MG256's function in the context of M. genitalium's minimal genome?

Integrative multi-omics approaches offer powerful strategies for elucidating MG256's function within M. genitalium's highly streamlined genome:

  • Complementary Omics Technologies:

    • Transcriptomics: Identify conditions affecting MG256 expression

    • Proteomics: Determine post-translational modifications and abundance

    • Interactomics: Map protein-protein interaction networks

    • Metabolomics: Detect metabolic changes associated with MG256 function

  • Data Integration Strategies:

    • Network-based integration to identify functional modules

    • Machine learning approaches for pattern recognition across datasets

    • Temporal analysis to capture dynamic processes

  • Minimal Genome Context:

    • M. genitalium has one of the smallest genomes of any free-living organism

    • Each protein likely serves essential or multifunctional roles

    • Context of MG256 within this minimal system provides clues to function

  • Active Learning Framework:

    • Implement experimental design approaches like those in GeneDisco

    • Optimize resource allocation for maximum information gain

    • Iteratively refine hypotheses based on multi-omics data

These integrative approaches are particularly valuable for studying uncharacterized proteins in minimal genomes, where traditional genetic approaches may be complicated by essential functions or complex phenotypes. For MG256, the context within M. genitalium's streamlined genome provides an opportunity to understand fundamental principles of protein function with fewer confounding variables than in more complex organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.