Recombinant Mycoplasma genitalium Uncharacterized protein MG279 (MG279)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Evolutionary Insights

MG279 is located in a region of the M. genitalium genome with low recombination activity, unlike other regions such as the MgPar loci (involved in antigenic variation) . A synonymous SNP (C→A) at position 340,583 in the MG279 coding sequence has been observed in some strains but does not alter the amino acid sequence .

This stability contrasts with other M. genitalium genes, such as mgpB and mgpC (adhesins), which undergo frequent recombination to evade host immunity . The conservation of MG279 suggests potential housekeeping roles, though functional data remain absent.

Comparative Analysis with Related Proteins

MG279 is part of a group of uncharacterized proteins in M. genitalium. Below is a comparison with MG281, another uncharacterized protein:

FeatureMG279MG281
Length218 amino acids Not explicitly stated (typically ~200–300 aa for similar proteins)
TagHis-tag Not specified
Purity>90% >85%
Expression HostE. coli E. coli (assumed based on common practices)
Known InteractionsNone reportedNone reported

Research Gaps and Functional Hypotheses

Despite its recombinant availability, MG279 has not been studied in functional assays. Potential avenues for research include:

  • Metabolic Roles: M. genitalium’s minimal genome suggests MG279 may participate in core processes like nucleotide metabolism or membrane transport.

  • Host Interaction: While MgPa (MG191/MG192) is a known adhesin , MG279’s role in pathogenicity remains unexplored.

  • Structural Homology: Computational models could predict interactions with thiamine (similar to MG289 ) or other cofactors.

Applications in Biomedical Research

Recombinant MG279 is primarily used in:

  • SDS-PAGE: To study protein folding and stability .

  • Antibody Development: As a potential antigen for serological assays (though M. genitalium serological targets typically focus on MgPa or MG075 ).

  • Protein-Protein Interaction Screens: To identify binding partners using techniques like pull-down assays.

Future Directions

  1. Functional Characterization: Knockout studies in M. genitalium to assess viability and metabolic impacts.

  2. Structural Analysis: X-ray crystallography or cryo-EM to predict binding sites.

  3. Immune Response Profiling: Testing human sera for MG279-specific antibodies to gauge its role in infection.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MG279; Uncharacterized protein MG279
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG279
Target Protein Sequence
MIRLLKKLAVFLIILVGILLLGGIATAGYFAFTYREPINNYYKEGYNKISEYNTEIKKIS QNIFQNNLVKTLSEVEKSLNEGRKLTQNNSFASGLDSSLNALEGSLKKINNFDSNAAFTQ IKHTLNNITSFVDQMLEKFPNPNQNDDFKRYLTEVSQILFYTGISIIGAFFVSGFLLILF TKKVYGVRVSRFNPQRLLKKHLVLLLRDEEVYDAVFGN
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_279

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the genomic context of MG279 inform its potential function?

MG279 is encoded within the minimalist genome of M. genitalium (only 580kb with approximately 480 potential gene products) . In the context of minimal genome studies, proteins like MG279 are of particular interest as they may represent essential functions required for a free-living organism. Its retention in this highly reduced genome suggests it serves an important function, potentially in membrane structure or host interaction.

Analysis of surrounding genes provides limited context, but within the characterized M. genitalium proteome, membrane proteins often play roles in adhesion, immune evasion, or nutrient acquisition . Genomic analysis using the complete M. genitalium sequence (accessible through systems containing SEQ ID NO:1 of the genome) allows researchers to examine promoter regions and potential operonic structures that might give clues to expression patterns .

What are the optimal conditions for recombinant expression of MG279?

For optimal recombinant expression of MG279, E. coli has been successfully used as an expression host for the full-length protein with a His-tag . Several methodological considerations are essential:

  • Codon optimization: Due to M. genitalium's low G+C content and different codon usage compared to E. coli (particularly UGA codons which encode tryptophan in Mycoplasma but serve as stop codons in E. coli), codon optimization of the sequence is critical for successful expression .

  • Expression vector selection: pET-based vectors with T7 promoters provide good control of expression for potentially toxic membrane proteins.

  • Induction parameters: IPTG concentration (typically 0.1-0.5 mM), temperature (reduced to 16-20°C after induction), and duration (extended to 16-20 hours) should be optimized to prevent formation of inclusion bodies.

  • Cell lysis conditions: Due to potential membrane association, detergent-based lysis buffers containing mild non-ionic detergents (0.5-1% Triton X-100 or NP-40) are recommended for initial extraction trials.

These recommendations are based on established protocols for membrane-associated bacterial proteins and specific experiences with other M. genitalium recombinant proteins .

What purification strategies are most effective for obtaining high-purity MG279 protein?

A multi-step purification strategy is recommended for obtaining high-purity MG279:

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Use Ni-NTA or TALON resin for initial capture of His-tagged MG279

  • Include low concentrations of detergent (0.05-0.1%) throughout purification

  • Implement a stepped imidazole gradient (10mM, 20mM, 50mM, 250mM) to reduce co-purifying contaminants

Step 2: Size Exclusion Chromatography (SEC)

  • Use Superdex 75 or 200 columns depending on oligomerization state

  • Buffer conditions: 50mM Tris-HCl pH 8.0, 150mM NaCl, 0.05% appropriate detergent

Step 3: Ion Exchange Chromatography (optional)

  • Based on theoretical pI of MG279

  • Can be used as a polishing step if higher purity is required

Quality Control Metrics:

  • SDS-PAGE should show >95% purity

  • Western blot with anti-His antibodies to confirm identity

  • Mass spectrometry to verify intact mass and sequence coverage

For structural studies, consider detergent screening (DDM, LDAO, C8E4) to identify conditions that maintain protein stability and monodispersity, as has been done with other membrane proteins from minimal genome bacteria .

What evidence suggests MG279 plays a role in M. genitalium pathogenesis?

While direct evidence for MG279's role in pathogenesis remains limited, several factors suggest it may contribute to M. genitalium's infection cycle:

  • Membrane localization: Based on sequence analysis, MG279 appears to be a membrane-associated protein, positioning it at the host-pathogen interface where it could mediate critical interactions .

  • Conservation in a minimal genome: M. genitalium has one of the smallest genomes of any free-living organism (~580kb). The preservation of MG279 in this highly reduced genome suggests functional importance .

  • Context from other membrane proteins: Other characterized membrane proteins in M. genitalium, particularly the MgPa adhesin encoded by the mgpB gene, play critical roles in:

    • Cell adhesion to host tissues

    • Antigenic variation to evade host immune responses

    • Persistence of infection in the reproductive tract

  • Potential immunomodulatory functions: Some M. genitalium membrane proteins interact with the host immune system. For instance, protein M (MG281, a different protein) has been identified as a universal antibody-binding protein . MG279 might have similar immunomodulatory properties that warrant investigation.

Research methodology to investigate MG279's pathogenic role should include gene knockout/knockdown studies in M. genitalium (challenging due to limited genetic tools), heterologous expression systems, and host cell interaction assays.

How can researchers investigate potential interactions between MG279 and host cells?

To investigate MG279-host interactions, a multi-faceted experimental approach is recommended:

In vitro binding assays:

  • Express recombinant MG279 with appropriate tags (His, GST, etc.)

  • Conduct pull-down assays with human cell lysates (preferably from relevant tissues such as urogenital epithelial cells)

  • Identify interaction partners using mass spectrometry

Cell-based functional assays:

  • Expose human epithelial cell lines to purified MG279 and assess:

    • Adherence/internalization using fluorescently labeled protein

    • Cytokine production (IL-6, IL-8, TNF-α)

    • Changes in host cell gene expression (RNA-seq)

    • Host cell signaling pathway activation (phosphorylation studies)

In vivo model systems:
The pig-tailed macaque (Macaca nemestrina) model has been validated for M. genitalium infection studies . This model could be adapted to study:

  • MG279-specific antibody responses

  • Effects of anti-MG279 antibodies on infection clearance

  • M. genitalium strains with modified MG279 expression

Structural biology approaches:

  • Protein crystallography or cryo-EM to determine MG279 structure

  • In silico docking with potential host receptors

  • Epitope mapping to identify immunogenic regions

These methodologies would provide comprehensive insights into MG279's potential role at the host-pathogen interface, complementing genomic and proteomic data already available for M. genitalium .

How can researchers assess the immunogenicity of MG279 in the context of M. genitalium infection?

Assessing MG279 immunogenicity requires a systematic approach combining serological, cellular, and molecular methods:

Serological approaches:

  • Develop ELISAs using purified recombinant MG279 to detect specific antibodies in:

    • Sera from M. genitalium-infected individuals

    • Cervicovaginal lavage samples (to assess mucosal responses)

    • Animal models following experimental infection

  • Western blot analysis to confirm antibody specificity and assess cross-reactivity

  • Multiplexed serological assays including MG279 alongside other M. genitalium antigens to determine its relative immunodominance

B-cell epitope mapping:

  • Generate overlapping peptides spanning the MG279 sequence

  • Screen peptides against sera from infected individuals

  • Confirm epitopes using site-directed mutagenesis of recombinant protein

T-cell response characterization:

  • Identify potential T-cell epitopes using prediction algorithms

  • Synthesize candidate epitope peptides

  • Assess T-cell responses using:

    • ELISPOT assays for IFN-γ, IL-4, and IL-17

    • Flow cytometry to characterize responding T-cell subsets

In vivo validation:
In the pig-tailed macaque model established for M. genitalium research , assess:

  • Kinetics of anti-MG279 antibody development

  • Correlation between antibody responses and bacterial clearance

  • Protection against challenge following immunization with recombinant MG279

Historical data from M. genitalium studies indicates that serum antibodies to membrane proteins like MgpB can be detected in infected humans and animal models, suggesting similar approaches would be productive for MG279 .

What methodologies can determine if MG279 undergoes antigenic variation similar to other M. genitalium surface proteins?

MgpB and MgpC in M. genitalium undergo extensive antigenic variation through genetic recombination with archived variant sequences (MgPar regions) . To investigate if MG279 experiences similar variation:

Genomic approaches:

  • Analyze the M. genitalium genome for potential MG279 variant sequences or homologous regions

  • Perform comparative genomics across multiple clinical isolates to identify polymorphic regions

  • Use long-read sequencing to capture complex structural variations

Experimental evolution:

  • Culture M. genitalium in the presence of immune pressure (antibodies targeting MG279)

  • Sequence MG279 from surviving populations at multiple timepoints

  • Compare to in vitro passage without immune selection

In vivo sequence tracking:
Using the pig-tailed macaque model :

  • Inoculate with clonal M. genitalium containing sequenced MG279

  • Collect samples at defined intervals (2-8 weeks)

  • Sequence MG279 from recovered organisms

  • Compare with the same strain propagated in vitro for equivalent time

Molecular mechanisms:
If variation is observed, investigate:

  • Recombination events using specialized PCR approaches

  • Expression of potential variant sequences using RT-PCR

  • Protein variations using mass spectrometry

The methodological approach established for tracking mgpB sequence variations would serve as an excellent template. In previous studies, after 8 weeks of infection in the macaque model, sequences within mgpB variable region were replaced by novel sequences through recombination with archived variants, while the same inoculum propagated in vitro remained unchanged .

What computational approaches can predict functional domains and interacting partners of MG279?

A comprehensive bioinformatic pipeline for MG279 functional prediction should include:

Structural and functional domain prediction:

  • Primary sequence analysis using InterPro, SMART, and Pfam

  • Transmembrane topology prediction using TMHMM, Phobius, and TOPCONS

  • Signal peptide prediction using SignalP and PrediSi

  • Secondary structure prediction using PSIPRED and JPred4

  • Intrinsically disordered regions using IUPred and PONDR

3D structure prediction:

  • Template-based modeling using homology detection tools (HHpred, FFAS)

  • Ab initio modeling using AlphaFold2 or RoseTTAFold

  • Refinement and validation using MolProbity and ProSA

Functional inference:

  • Gene ontology term prediction using tools like DeepGOPlus

  • Functional site prediction using ConSurf (evolutionary conservation)

  • Ligand binding site prediction using COACH and FTSite

Protein-protein interaction prediction:

  • Interolog mapping using established PPI databases (STRING, IntAct)

  • Domain-based interaction prediction (DOMINE, 3did)

  • Structure-based protein-protein docking using HADDOCK or ClusPro

  • Host-pathogen interaction prediction using specialized tools like HPIDB

Integrated analysis:
Create a consensus functional prediction by integrating multiple lines of evidence, weighting results based on confidence scores and biological context from the minimal genome of M. genitalium .

This comprehensive approach has proven effective for characterizing hypothetical proteins in other minimal genome organisms and would be particularly valuable for MG279 given the limited experimental data currently available.

How can phylogenetic analysis of MG279 homologs inform its functional significance?

Phylogenetic analysis of MG279 can reveal evolutionary patterns that provide insights into functional constraints and importance:

Homolog identification methodology:

  • Perform sensitive sequence searches using PSI-BLAST, HHblits, and HMMER against:

    • NR database (comprehensive coverage)

    • UniProtKB (curated functional information)

    • Focused databases of minimal genome organisms

  • Validate potential homologs using:

    • Reciprocal best hit approach

    • Domain architecture comparison

    • Genomic context conservation

Multiple sequence alignment strategy:

  • Generate initial alignments using MAFFT or Clustal Omega

  • Refine alignments focusing on conserved regions using MUSCLE or T-Coffee

  • Manually curate alignments, particularly for transmembrane regions

  • Assess alignment quality using scores like CORE or TCS

Phylogenetic reconstruction:

  • Select appropriate evolutionary models using ModelTest or ProtTest

  • Construct trees using multiple methods:

    • Maximum Likelihood (RAxML, IQ-TREE)

    • Bayesian inference (MrBayes, PhyloBayes)

  • Assess tree robustness using bootstrapping or posterior probabilities

Evolutionary analysis:

  • Calculate evolutionary rates using PAML or HyPhy

  • Identify sites under selective pressure (conserved vs. variable)

  • Examine co-evolution patterns with other proteins

  • Map conservation patterns onto predicted structural models

Functional inference from phylogenetic patterns:

  • Distribution across Mycoplasma species with different tissue tropisms

  • Correlation between gene presence and specific pathogenic phenotypes

  • Patterns of gene loss/retention in minimal genome evolution

  • Horizontal gene transfer events

This methodology has been successfully applied to study the evolution of minimal genome organisms like Mycoplasma, providing insights into core functions and species-specific adaptations .

What gene-editing strategies can be employed to study MG279 function in M. genitalium?

Genetic manipulation of M. genitalium presents unique challenges due to its minimal genome and limited genetic tools. A comprehensive approach includes:

Transposon mutagenesis:

  • Use Tn4001 or derivatives modified for M. genitalium

  • Screen for viable transformants (suggesting non-essential function) or

  • Attempt targeted disruption coupled with complementation

  • Employ transposon delivery via electroporation rather than transformation

  • Use selective markers appropriate for mycoplasma (tetracycline or gentamicin resistance)

CRISPR-Cas9 adaptation for M. genitalium:

  • Optimize Cas9 expression using appropriate mycoplasma promoters and codon optimization

  • Design sgRNAs targeting MG279 with minimal off-target effects

  • Deliver components via liposome-mediated transformation

  • Use homology-directed repair templates to introduce specific mutations

  • Include selectable markers and counterselection systems

Conditional expression systems:

  • Develop tetracycline-responsive promoters calibrated for M. genitalium

  • Create MG279 depletion strains (if essential)

  • Implement riboswitch-based expression control

Complementation approaches:

  • Express wild-type or mutant versions of MG279 from alternative genomic loci

  • Use plasmid-based expression systems if stable maintenance can be achieved

  • Employ heterologous complementation in related Mycoplasma species

Phenotypic characterization:
Following genetic manipulation, assess effects on:

  • Growth kinetics and viability

  • Cell morphology and membrane integrity

  • Adherence to human epithelial cells

  • Persistence in infection models

  • Susceptibility to host defense mechanisms

While genetic tools for M. genitalium are not as developed as for other bacteria, the relatively small genome size (~580kb) facilitates whole-genome screening approaches and simplifies off-target effect analysis .

How can advanced imaging techniques be applied to study MG279 localization and dynamics?

Advanced imaging techniques provide powerful tools for visualizing MG279 within the cellular context of M. genitalium:

Sample preparation methodologies:

  • Fluorescent protein fusions:

    • Generate C- or N-terminal fusions of MG279 with mNeonGreen or mScarlet

    • Validate fusion functionality through complementation assays

    • Express under native promoter to maintain physiological levels

  • Immunofluorescence approaches:

    • Develop high-specificity antibodies against purified MG279

    • Optimize fixation protocols for M. genitalium (paraformaldehyde + gentle permeabilization)

    • Use both conventional and super-resolution compatible fluorophores

  • Click chemistry for pulse-chase:

    • Incorporate non-canonical amino acids into MG279

    • Perform bio-orthogonal labeling with fluorescent tags

    • Track protein turnover and trafficking

Advanced microscopy techniques:

  • Super-resolution microscopy:

    • Structured illumination microscopy (SIM) for ~100nm resolution

    • STORM/PALM for ~20nm resolution to resolve fine distribution

    • Expansion microscopy to physically enlarge small M. genitalium cells

  • Live-cell imaging:

    • High-speed confocal for dynamic processes

    • Light sheet microscopy for reduced phototoxicity

    • Single-molecule tracking for diffusion and interaction studies

  • Correlative light and electron microscopy (CLEM):

    • Connect fluorescent signals to ultrastructural context

    • Immunogold labeling for transmission electron microscopy

    • Cryo-electron tomography for native state visualization

Host-pathogen interface visualization:

  • Examine MG279 distribution during adherence to host cells

  • Track potential redistribution during different infection stages

  • Co-visualization with host receptors or immune components

Quantitative analysis:

  • Measure co-localization with other bacterial components

  • Assess clustering behavior under different conditions

  • Determine orientation relative to the cell membrane

These advanced imaging approaches have been successfully applied to other minimal genome bacteria and would provide unprecedented insights into MG279's spatial organization and dynamics .

What proteomic approaches can identify the interactome of MG279 within M. genitalium?

A comprehensive proteomic strategy to map MG279's interactome should include:

Affinity-based approaches:

  • Co-immunoprecipitation (Co-IP):

    • Generate high-specificity antibodies against MG279

    • Optimize gentle lysis conditions to preserve membrane protein complexes

    • Use chemical crosslinkers to stabilize transient interactions

    • Identify interacting partners via mass spectrometry

  • Proximity labeling techniques:

    • Generate MG279 fusions with BioID or APEX2 enzymes

    • Express in M. genitalium under native control

    • Identify proximal proteins through streptavidin pulldown and MS

    • Compare results with control labeling experiments

Structural interactomics:

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to intact cells

    • Isolate MG279-containing complexes

    • Identify crosslinked peptides to map interaction interfaces

    • Determine spatial constraints for molecular modeling

  • Native mass spectrometry:

    • Isolate membrane complexes using gentle detergents

    • Analyze intact complexes by native MS

    • Determine stoichiometry and stability of interactions

Functional validation:

  • Bacterial two-hybrid assays:

    • Screen MG279 against M. genitalium proteome

    • Confirm direct binary interactions

    • Map interaction domains through truncation analysis

  • Fluorescence-based interaction assays:

    • FRET pairs to confirm proximity in live cells

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence correlation spectroscopy for dynamics

Data integration and network analysis:

  • Generate confidence-scored interaction network

  • Map interactions to M. genitalium cellular processes

  • Identify hub proteins and critical interactions

  • Compare with interactomes of homologs in related species

This multi-faceted approach would generate a high-confidence interactome, providing context for MG279 function. M. genitalium's small proteome (~480 proteins) makes comprehensive screening more feasible than in more complex organisms .

How can researchers investigate post-translational modifications of MG279?

Despite having a minimal genome, M. genitalium proteins exhibit post-translational modifications (PTMs). A systematic investigation of MG279 PTMs includes:

Mass spectrometry-based PTM discovery:

  • Sample preparation strategies:

    • Enrich MG279 using immunoprecipitation or His-tag pulldown

    • Apply multiple proteolytic enzymes (trypsin, chymotrypsin, etc.)

    • Fractionate peptides using strong cation exchange

  • Enrichment of modified peptides:

    • Phosphorylation: IMAC, titanium dioxide, or antibody-based

    • Glycosylation: lectin affinity or hydrazide chemistry

    • Lipidation: click chemistry-based approaches

  • Advanced MS workflows:

    • Electron-transfer dissociation for labile modifications

    • Parallel reaction monitoring for targeted quantification

    • Data-independent acquisition for comprehensive coverage

Targeted PTM site analysis:

  • Generate site-specific antibodies for identified PTMs

  • Create site-directed mutants (S/T/Y→A for phosphorylation)

  • Compare wild-type and mutant protein function

PTM enzymes identification:

  • Screen kinases/phosphatases in M. genitalium

  • Use inhibitors to modulate modification levels

  • Assess PTM changes under different growth conditions

Functional impact assessment:

  • Effect of PTMs on:

    • Protein localization

    • Protein-protein interactions

    • Stability and turnover

    • Activity (if functional assays available)

  • Dynamic changes during:

    • Cell cycle progression

    • Host cell interaction

    • Stress responses

Proteomics studies of M. genitalium have identified a ratio of 1.22:1 proteins to genes, suggesting significant post-translational processing even in this minimal organism . This methodology would provide insights into how PTMs contribute to MG279 function in this streamlined bacterium.

What methodologies can determine if MG279 could serve as a diagnostic biomarker for M. genitalium infections?

A systematic evaluation of MG279 as a diagnostic biomarker would include:

Analytical validation studies:

  • Antibody development and characterization:

    • Generate monoclonal antibodies against multiple epitopes

    • Assess specificity against related Mycoplasma species

    • Determine sensitivity limits for purified protein

  • Assay development:

    • Enzyme-linked immunosorbent assays (ELISA)

    • Lateral flow immunoassays for point-of-care testing

    • Multiplex bead-based assays including other M. genitalium antigens

  • PCR-based detection:

    • Design MG279-specific primers with appropriate controls

    • Compare sensitivity to established targets like MgPa

    • Evaluate in multiplex PCR formats

Clinical validation:

  • Sample types assessment:

    • Urethral/vaginal swabs

    • Urine specimens

    • Cervical samples

  • Performance metrics:

    • Sensitivity and specificity compared to nucleic acid amplification tests

    • Positive and negative predictive values

    • Receiver operating characteristic (ROC) analysis

  • Special populations:

    • Asymptomatic carriers

    • Co-infected patients

    • Patients with antibiotic-resistant strains

Host response markers:

  • Anti-MG279 antibody levels as indirect diagnostic markers

  • Correlation with infection duration and severity

  • Changes following antibiotic treatment

Comparative studies:
Evaluate MG279 alongside established diagnostic targets:

TargetDetection MethodSensitivitySpecificityAdvantagesLimitations
MG279Protein detectionTo be determinedTo be determinedPotential membrane localizationUncharacterized protein
MgPaPCR/immunoassay90-95%98-99%Well-establishedVariable regions
16S rRNAPCR85-95%99%Conserved sequenceCross-reactivity
rRNATMA (Aptima)95-98%>99%High sensitivitySpecialized equipment

The increasing prevalence of M. genitalium infections and growing antibiotic resistance highlights the need for improved diagnostic approaches, making evaluation of novel biomarkers like MG279 particularly relevant.

How can researchers evaluate MG279 as a potential vaccine target against M. genitalium infections?

Evaluating MG279 as a vaccine candidate requires a comprehensive approach:

Antigen characterization:

  • Epitope mapping:

    • Identify B-cell epitopes using overlapping peptides

    • Predict and validate T-cell epitopes

    • Assess conservation across M. genitalium strains

  • Accessibility studies:

    • Confirm surface exposure using proteolytic shaving

    • Evaluate antibody binding to intact organisms

    • Determine orientation in the membrane

  • Functional significance:

    • Assess if antibodies against MG279 neutralize bacterial function

    • Determine if MG279 is involved in adhesion or invasion

    • Evaluate growth inhibition with anti-MG279 antibodies

Immunization studies in animal models:

  • Formulation development:

    • Full-length protein vs. epitope-focused approaches

    • Adjuvant selection and optimization

    • Delivery system evaluation (liposomes, virus-like particles)

  • Immunogenicity assessment:

    • Antibody titer and specificity

    • T-cell responses (Th1/Th2/Th17)

    • Mucosal immune responses

  • Challenge studies:

    • Protocol adaptation for the pig-tailed macaque model

    • Bacterial load quantification following challenge

    • Histopathological evaluation of reproductive tissues

    • Duration of protection assessment

Potential for antigenic variation:

  • Determine if MG279 undergoes sequence variation like MgpB/MgpC

  • Assess if variation affects protective epitopes

  • Evaluate breadth of protection against diverse strains

Integration with other antigens:

  • Compare and combine with other M. genitalium antigens

  • Evaluate synergistic protection in multivalent formulations

  • Balance immunodominance in combination approaches

Though M. genitalium has evolved mechanisms to evade host immunity through antigenic variation of surface proteins , if MG279 proves to be more conserved, it could provide advantages over highly variable proteins like MgpB. The analysis of sequences across clinical isolates would be essential to determine conservation and suitability as a vaccine target.

The development of effective vaccines against M. genitalium is particularly important given the rising concerns about antibiotic resistance, including macrolide resistance rates of 40-50% documented in some populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.