Recombinant Mycoplasma genitalium Uncharacterized protein MG319 (MG319)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To request a specific tag, please specify this in your order; we will prioritize fulfilling custom tag requests.
Synonyms
MG319; Uncharacterized protein MG319
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG319
Target Protein Sequence
MRLFRFLFKLCFLLLVLVGFAYLFLAIFYFGSLNPFELAQPMDVFNRFFSKEALDNISSN NGATATAQTSSLLQLLEGSSNGLDNRFPTEKSAFYAIPGYVDFLKNAKLPGFVEQFTPYL TKYVIPLGMAFVSGLIGTLIVNFFLNKITRSIKRRKRNMKKQEQEEYYDDSRSRRKRN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should researchers properly store and handle recombinant MG319 for optimal stability?

For optimal stability, store recombinant MG319 protein at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles. The lyophilized powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (recommended final concentration is 50%) for long-term storage. Working aliquots can be stored at 4°C for up to one week. The storage buffer typically comprises Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What evidence suggests MG319 may have functional significance in Mycoplasma genitalium?

While MG319 remains uncharacterized, several indicators suggest its potential significance:

  • Conservation across Mycoplasma species (including homologs in M. pneumoniae)

  • Predicted membrane association (based on hydrophobicity analysis)

  • Potential structural features identified through computational analysis

  • Expression verification in bacterial host systems

These characteristics suggest MG319 may play a role in cellular processes like membrane integrity, cell signaling, or host-pathogen interactions .

What computational approaches can effectively predict the function of uncharacterized proteins like MG319?

Several computational approaches can be applied to predict MG319's function:

ApproachMethodologyExpected OutcomesLimitations
Conserved Domain AnalysisIdentify functional motifs using NCBI CDD, Pfam, SMARTPotential functional domains and superfamily associationsMay miss novel or unique domains
Structural PredictionAlphaFold, I-TASSER, SWISS-MODEL3D structure models and potential binding sitesAccuracy depends on template quality
Homology AnalysisBLASTp, HHpredFunctional inference from similar proteinsLimited by existing characterized homologs
Subcellular LocalizationPSORTb, SignalP, TMHMMCellular location predictionBacterial-specific limitations
Functional NetworksSTRING, GeneMANIAPredicted protein-protein interactionsOften based on co-expression rather than physical interaction

When applied systematically, these approaches have demonstrated efficacy in characterizing previously unknown proteins in bacterial systems . For MG319 specifically, a thioredoxin-like fold has been predicted, suggesting potential involvement in redox processes.

How can researchers design experimental approaches to validate computational predictions for MG319?

A systematic validation approach includes:

  • Expression System Optimization:

    • Express MG319 in E. coli with appropriate fusion tags (His-tag is commonly used)

    • Optimize expression conditions to maximize protein yield while maintaining proper folding

    • Purify using affinity chromatography followed by size exclusion chromatography

  • Structural Validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • X-ray crystallography or NMR spectroscopy for high-resolution structure determination

    • Compare experimental structure with computational predictions

  • Functional Assays:

    • Design targeted assays based on computational predictions

    • For potential thioredoxin-like activity: measure redox potential, thiol oxidoreductase activity

    • Protein-protein interaction studies using pull-down assays, yeast two-hybrid, or BioID

  • In vivo Significance:

    • Generate knockout mutants in M. genitalium

    • Assess phenotypic changes under various stress conditions

    • Complementation studies to confirm phenotype is specifically linked to MG319

This integrated approach has successfully characterized numerous bacterial proteins previously designated as "hypothetical" .

What are the challenges in distinguishing between direct and indirect effects in MG319 knockout studies?

Researchers face several methodological challenges when interpreting MG319 knockout phenotypes:

  • Pleiotropic Effects: MG319 deletion may affect multiple cellular processes, making it difficult to identify primary function.

  • Compensatory Mechanisms: Bacteria often upregulate alternative pathways to compensate for deleted genes, masking the true function.

  • Strain-Specific Differences: Different laboratory strains of M. genitalium may show variable responses to MG319 deletion.

  • Experimental Controls:

    • Include complementation studies with wild-type MG319

    • Use point mutations to disrupt specific predicted domains

    • Employ inducible expression systems to control timing of MG319 expression

  • Multi-omics Approach: Combine transcriptomics, proteomics, and metabolomics to distinguish direct vs. indirect effects.

Comparing results across multiple experimental conditions (e.g., different stress exposures) can help identify the primary function from secondary effects .

How can researchers effectively implement distributional discrepancy minimization (DDM) in experimental designs involving MG319?

When designing experiments to investigate MG319 function, DDM approaches can optimize treatment-control assignments:

  • Experimental Design Considerations:

    • Balance treatment groups to minimize confounding variables

    • Account for unequal treatment-control assignment probabilities

    • Implement stratified randomization when testing multiple conditions

  • Statistical Implementation:

    • Apply Multiplicative Weights Update (MWU) algorithms to reduce worst-case mean squared error

    • Consider NP-hardness of optimal DDM solutions when designing experiments

    • Balance computational complexity with experimental precision requirements

  • Practical Application:

    • For protein interaction studies: ensure proper controls for non-specific binding

    • For functional assays: implement internal controls to normalize results

    • For multi-condition experiments: design factorial experiments with appropriate controls

This approach has demonstrated improved statistical power and reduced bias in complex experimental designs involving multiple variables .

What methodologies are most effective for investigating potential interactions between MG319 and host cells?

Investigation of MG319-host interactions requires a multi-faceted approach:

MethodologyApplicationAdvantagesLimitations
Yeast Two-HybridScreen for direct protein interactionsHigh-throughput, in vivoHigh false positive rate
Pull-down AssaysValidate specific interactionsDirect biochemical evidenceRequires antibodies or tags
Co-immunoprecipitationDetect native complexesPreserves physiological contextMay disrupt weak interactions
Proximity Labeling (BioID)Identify neighborhood proteinsCaptures transient interactionsRequires genetic modification
Cell Culture Infection ModelsObserve effects on host cellsPhysiological relevanceComplex to interpret
TranscriptomicsHost response to MG319 exposureGenome-wide effectsIndirect evidence of interaction

For MG319 specifically, researchers should consider its potential membrane localization when designing interaction studies. If MG319 is exposed on the bacterial surface, it might directly interact with host cell receptors or extracellular matrix components .

How should researchers interpret contradictory findings between in silico predictions and experimental results for MG319?

When faced with discrepancies between computational predictions and experimental data:

  • Reassess Computational Models:

    • Check if predictions used outdated databases or algorithms

    • Consider alternative models with different parameters

    • Evaluate confidence scores of predictions

  • Review Experimental Conditions:

    • Examine if protein was properly folded and active

    • Consider if experimental conditions match physiological environment

    • Assess potential artifacts from tags or expression systems

  • Reconciliation Approaches:

    • Generate alternative hypotheses that explain both datasets

    • Design targeted experiments to test specific aspects of conflicting results

    • Consider that MG319 may have multiple functions or context-dependent activity

  • Iteration Process:

    • Use experimental data to refine computational models

    • Design new computational analyses based on experimental insights

    • Implement an iterative cycle between prediction and validation

This systematic approach has successfully resolved contradictions in characterizing other hypothetical bacterial proteins .

What strategies can address the challenges of expressing and purifying functionally active MG319?

Researchers face several challenges with MG319 expression and purification:

  • Expression System Selection:

    • E. coli is commonly used but may not provide proper folding for all proteins

    • Consider cell-free expression systems for potentially toxic proteins

    • Evaluate expression in multiple bacterial hosts with different growth conditions

  • Solubility Enhancement:

    • Optimize fusion tags (MBP, SUMO, or thioredoxin tags often improve solubility)

    • Screen different buffer compositions during purification

    • Test co-expression with chaperones

  • Functional Preservation:

    • Minimize exposure to harsh conditions during purification

    • Verify protein folding using circular dichroism or fluorescence spectroscopy

    • Include stabilizing agents like glycerol or specific ions if needed

  • Quality Control Metrics:

    • Assess purity by SDS-PAGE (target >90% for functional studies)

    • Verify identity by mass spectrometry

    • Test activity using functional assays developed based on predictions

These approaches have successfully overcome expression challenges for other Mycoplasma proteins with challenging properties .

How can researchers effectively integrate multi-omics data to elucidate MG319 function in the context of Mycoplasma genitalium biology?

A comprehensive multi-omics strategy includes:

  • Data Integration Framework:

    • Establish a consistent experimental design across omics platforms

    • Implement computational pipelines for integrating heterogeneous data types

    • Apply network analysis to identify functional relationships

  • Sequential Application:

    • Start with transcriptomics to identify conditions where MG319 is expressed

    • Apply proteomics to confirm translation and identify post-translational modifications

    • Use metabolomics to detect changes in metabolic pathways upon MG319 deletion

  • Contextual Analysis:

    • Compare data from wild-type and MG319 knockout strains

    • Analyze under multiple stress conditions to detect condition-specific functions

    • Map results to known metabolic and signaling pathways

  • Advanced Statistical Approaches:

    • Apply machine learning algorithms to identify patterns across datasets

    • Implement Bayesian networks to determine causal relationships

    • Utilize dimensionality reduction techniques to visualize complex relationships

This integrated approach has successfully characterized numerous hypothetical proteins in bacterial systems by placing them in their biological context .

What emerging technologies offer promising approaches for characterizing uncharacterized proteins like MG319?

Several cutting-edge technologies show potential for elucidating MG319 function:

TechnologyApplicationPotential Impact
AlphaFold and RoseTTAFoldHighly accurate structural predictionMay reveal functional sites without crystallography
Cryo-EMHigh-resolution structural analysisWorks with smaller protein quantities than X-ray crystallography
CRISPR InterferencePrecise gene regulationAllows titration of MG319 expression to study dosage effects
Single-cell ProteomicsCell-to-cell protein variationMay reveal heterogeneous expression patterns in bacterial populations
Proximity-dependent LabelingIn situ protein interactionsCaptures physiologically relevant protein networks
MicrofluidicsHigh-throughput functional screeningEnables testing of multiple conditions simultaneously

These technologies can overcome traditional limitations in characterizing challenging proteins and provide complementary lines of evidence for functional determination .

How can researchers design comprehensive experiments to determine if MG319 plays a role in Mycoplasma genitalium pathogenesis?

A systematic approach to investigate MG319's role in pathogenesis includes:

  • In Vitro Models:

    • Infection assays with wild-type vs. MG319 knockout strains

    • Cell adhesion and invasion quantification

    • Cytotoxicity and inflammatory response measurements

    • Host cell transcriptomics to assess response differences

  • Comparative Studies:

    • Analyze MG319 homologs across Mycoplasma species with varying pathogenicity

    • Examine sequence variants in clinical isolates with different virulence

  • Functional Assays:

    • Test for activities associated with virulence (e.g., immune evasion, adherence)

    • Assess impact of environmental conditions mimicking host environments

    • Evaluate contribution to stress resistance (oxidative, pH, osmotic)

  • Translational Aspects:

    • Immunological studies to determine if MG319 is recognized by host immune system

    • Evaluate potential as diagnostic biomarker or therapeutic target

These approaches have successfully identified virulence factors in other bacterial pathogens initially classified as hypothetical proteins .

What standardized reporting practices should be followed when publishing research on uncharacterized proteins like MG319?

To ensure reproducibility and facilitate comparative analyses:

  • Experimental Details:

    • Provide complete amino acid sequence including any tags

    • Detail expression conditions, purification methods, and final purity

    • Specify buffer compositions and storage conditions

    • Include all quality control metrics (e.g., SDS-PAGE images, mass spectrometry data)

  • Computational Analyses:

    • List all software versions, parameters, and databases used

    • Provide confidence scores and statistical significance

    • Make raw data and analysis scripts available in public repositories

  • Results Reporting:

    • Clearly distinguish between experimental results and predictions

    • Include negative results and failed approaches

    • Provide adequate controls for all experiments

    • Quantify results with appropriate statistical analyses

  • Data Deposition:

    • Submit sequences to databases like UniProt

    • Deposit structures in Protein Data Bank (PDB)

    • Share raw data in appropriate repositories (e.g., PRIDE for proteomics)

Following these practices enhances data quality and accelerates progress in characterizing uncharacterized proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.