Recombinant Mycoplasma genitalium Uncharacterized protein MG320 (MG320)

Shipped with Ice Packs
In Stock

Description

  • Antigen for polyclonal antibody production .

  • Protein-protein interaction studies (e.g., yeast two-hybrid screens) .

  • Structural analysis (pending crystallization efforts) .

Functional Insights from Genomic Context

Though direct functional studies are lacking, genomic and proteomic analyses provide indirect clues:

  • Operon proximity: MG_320 is adjacent to recA (MG_339), a critical recombination mediator in M. genitalium .

  • Regulatory role: Upstream sequences of MG_320 may influence RecA expression, suggesting a potential role in modulating homologous recombination during antigenic variation .

  • Pathogenicity link: Proteins co-localized with MG320 in the cell division cluster (e.g., FtsZ) are essential for mycoplasma survival and virulence .

Interactions and Pathways

Putative interactors:

  • RPL35: A ribosomal protein implicated in host cell proliferation during M. genitalium infection .

  • CypA/CD147: Cyclophilin A and its receptor, which mediate inflammatory responses to mycoplasma adhesins .

Pathway associations:

PathwayRelated Proteins
Cell divisionFtsZ, MraZ, MraW
Antigenic variationRecA, RuvA, RuvB

Research Gaps and Future Directions

  • Functional validation: No studies have directly linked MG320 to adhesion, motility, or DNA repair mechanisms, unlike characterized M. genitalium proteins (e.g., MgPa, RecA) .

  • Structural studies: Atomic-resolution data are needed to identify binding sites or enzymatic activity.

  • In vivo models: Role in infection dynamics (e.g., persistence, immune evasion) remains unexplored.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
MG320; Uncharacterized protein MG320
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG320
Target Protein Sequence
MINSTKGYIDQNGLAAKQFVQTKQLSVIRLTFMVAAFGIFFIFLVALTVQQLLSRSTLID LASDFRTLSTIAVITSFVSLILYFVTAFKLRNPNTSLTWFWALIITDVISYGITLGILLT LATTFSKQVNFEANDIVYAFLGASLVFGSVWGLSALPSQKRRYQQTQTLFHILLWAFVIS IVASLLSFILNFTVFASTTNLLDRIIPGLSLIVGGIFSLISVYFVSLQIRNEQDLIKYYE SEDYEMARRQSWRSALFFGAWLISSFMNLVYFILRIILITKNFSRV
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What methods are recommended for expressing recombinant MG320 protein?

For expressing recombinant MG320, a heterologous expression system optimized for membrane proteins is recommended. Given the challenges associated with expressing prokaryotic membrane proteins, multiple expression strategies should be explored:

  • E. coli-based expression systems:

    • BL21(DE3) strains with pET vector systems can be used for initial attempts

    • C41(DE3) or C43(DE3) strains, which are engineered specifically for membrane protein expression

    • Use of fusion tags such as MBP, SUMO, or GST to enhance solubility

  • Cell-free expression systems:

    • These systems circumvent toxicity issues often encountered with membrane proteins

    • Suitable for producing sufficient quantities for initial characterization studies

  • Codon optimization:

    • Essential due to the different codon usage between Mycoplasma species and common expression hosts

    • Synthetic gene constructs with optimized codons significantly improve expression yields

Expression conditions should be carefully optimized, including induction temperature (typically lower temperatures around 16-18°C reduce aggregation), inducer concentration, and duration of expression. Similar approaches have been successfully employed for other Mycoplasma proteins like MgPa .

How can I verify the correct folding and functionality of recombinant MG320?

Verification of correct folding and functionality for MG320 requires multiple complementary approaches:

  • Circular Dichroism (CD) spectroscopy:

    • Provides information about secondary structure content

    • Can confirm the predicted alpha-helical content expected from transmembrane domains

  • Limited proteolysis:

    • Properly folded proteins often show distinct proteolytic patterns

    • Compare proteolytic patterns of recombinant protein with native protein extracted from M. genitalium

  • Functionality assays:

    • Binding studies with potential interaction partners

    • Assessment of membrane insertion using liposome incorporation assays

    • Cell-based assays examining host response similar to those used for MG309

  • Thermal shift assays:

    • Evaluates protein stability and proper folding

    • Can be used to optimize buffer conditions for downstream applications

It's important to note that since MG320 is uncharacterized, functional verification may require hypothesizing its role based on sequence similarities with other characterized proteins from Mycoplasma species and designing appropriate assays to test these hypotheses.

What are the recommended approaches for determining the structure of MG320?

Given that MG320 is a membrane protein, structural determination presents significant challenges. A multi-technique approach is recommended:

For initial characterization, I recommend starting with computational prediction followed by experimental validation of specific structural features using techniques such as disulfide mapping or site-directed spin labeling coupled with EPR spectroscopy.

How can I predict the membrane topology of MG320?

Predicting the membrane topology of MG320 involves multiple computational and experimental approaches:

  • Computational methods:

    • TMHMM, HMMTOP, or Phobius for transmembrane helix prediction

    • SignalP for signal peptide prediction

    • TOPCONS for consensus topology prediction

  • Experimental validation methods:

    • PhoA/LacZ fusion approach: Creating fusions at different positions and assessing activity to determine cytoplasmic vs. periplasmic localization

    • Substituted cysteine accessibility method (SCAM): Introducing cysteines and testing accessibility to membrane-impermeant reagents

    • Protease protection assays: Limited proteolysis followed by mass spectrometry to identify protected regions

Based on preliminary analysis, MG320 likely contains 6-7 transmembrane domains with both N- and C-termini potentially exposed to the extracellular environment, similar to other bacterial adhesion proteins. This topology would be consistent with a potential role in host-pathogen interactions.

What methods should I use to investigate potential binding partners of MG320?

Identifying binding partners for an uncharacterized protein like MG320 requires systematic screening approaches:

  • Pull-down assays:

    • Using purified MG320 as bait with potential host cell lysates

    • Can be combined with mass spectrometry for unbiased identification (similar to approaches used with MgPa )

    • Requires confirmation with reciprocal co-immunoprecipitation

  • Yeast two-hybrid or bacterial two-hybrid screening:

    • For detecting protein-protein interactions

    • May require using soluble domains if full-length protein disrupts membrane integrity

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

    • For quantitative binding kinetics with candidate partners

    • Requires immobilization strategies suitable for membrane proteins

  • Phage display technology:

    • Similar to the T7 phage-displayed cDNA library approach used for identifying MgPa interactions

    • Can identify both protein and peptide ligands

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies interaction interfaces at amino acid resolution

    • Particularly useful for transient interactions

Given that other M. genitalium proteins like MgPa interact with host proteins such as RPL35 to promote cell proliferation , I would recommend initially screening for interactions with host ribosomal proteins, cytoskeletal components, and cell surface receptors.

How can I assess the role of MG320 in M. genitalium pathogenesis?

Investigating the role of MG320 in pathogenesis requires multiple complementary approaches:

  • Gene knockout or knockdown studies:

    • CRISPR interference or antisense oligonucleotides to reduce expression

    • Evaluate effects on bacterial attachment, invasion, and persistence

  • Heterologous expression in non-pathogenic models:

    • Express MG320 in related non-pathogenic mycoplasma species

    • Assess whether this confers new pathogenic properties

  • Cell culture infection models:

    • Compare wild-type and MG320-deficient strains for their ability to:

      • Adhere to urogenital epithelial cells

      • Trigger inflammatory responses (cytokine production)

      • Induce cytopathic effects

  • Transcriptomics and proteomics:

    • Analyze host cell responses to purified MG320 protein

    • Similar to studies with MG309 that showed activation of NF-κB via TLR2/6

  • In vivo models:

    • Using appropriate animal models to assess colonization and disease progression

    • Compare MG320 mutants with wild-type strains

Based on studies of other M. genitalium proteins, particularly MG309 which activates NF-κB via TLR2/6 , it would be worthwhile to investigate whether MG320 similarly engages innate immune receptors and contributes to inflammatory responses in the urogenital tract.

What techniques should I use to determine if MG320 functions as an adhesin?

Given that M. genitalium utilizes adhesin proteins for host cell attachment, determining whether MG320 functions as an adhesin involves:

  • Adhesion inhibition assays:

    • Pre-treat host cells with purified MG320 before infection

    • Use anti-MG320 antibodies to block bacterial attachment

  • Microsphere adhesion assays:

    • Coat fluorescent microspheres with purified MG320

    • Quantify attachment to various cell types and tissues

  • Domain mapping studies:

    • Generate truncated versions of MG320

    • Identify minimal regions required for adhesion

    • Similar to studies done with MgPa protein

  • Binding specificity analysis:

    • Screen attachment to different cell types and extracellular matrix components

    • Identify potential receptors through receptor depletion studies

  • Live cell imaging:

    • Fluorescently label both MG320 and potential host receptors

    • Track interaction dynamics in real-time

The amino acid sequence of MG320 contains hydrophobic regions that could potentially mediate membrane interactions, similar to other bacterial adhesins. Comparing the adhesive properties of wild-type and MG320-deficient M. genitalium strains would provide direct evidence for its role in attachment.

What are the optimal conditions for purifying MG320 while maintaining its native conformation?

Purification of membrane proteins like MG320 requires careful selection of detergents and buffer conditions:

  • Detergent screening:

    • Test multiple detergent classes:

      • Mild (DDM, LMNG)

      • Intermediate (DM, OG)

      • Harsh (SDS, LDAO)

    • Evaluate protein stability using fluorescence-based thermal shift assays

  • Affinity purification:

    • Utilize fusion tags (His, FLAG, Twin-Strep)

    • Implement on-column detergent exchange if necessary

  • Size exclusion chromatography:

    • Critical for removing aggregates and ensuring monodispersity

    • Can provide information about oligomeric state

  • Alternative membrane mimetics:

    • Nanodiscs or SMALPs for detergent-free extraction

    • Amphipols for enhanced stability after detergent removal

    • Liposomes for functional reconstitution

A typical purification workflow would involve:

  • Membrane isolation from expression host

  • Solubilization with optimized detergent (starting with 1% DDM)

  • IMAC purification using His-tag

  • Detergent exchange to a milder detergent if necessary

  • Size exclusion chromatography

  • Validation of structure using CD spectroscopy

Based on experience with other mycoplasma membrane proteins, the addition of cholesterol during purification may enhance stability due to the cholesterol-rich nature of mycoplasma membranes.

How can I assess the quality and homogeneity of purified MG320 preparations?

Assessing the quality and homogeneity of purified MG320 involves multiple analytical techniques:

  • SDS-PAGE and Western blotting:

    • Evaluate purity and integrity

    • Detect potential degradation products

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

    • Determine absolute molecular weight

    • Assess detergent contribution to protein-detergent complex

  • Dynamic light scattering (DLS):

    • Measure polydispersity index

    • Detect aggregation tendencies

  • Negative stain electron microscopy:

    • Visualize particle homogeneity

    • Identify potential structural features

  • Mass spectrometry:

    • Confirm protein identity

    • Detect post-translational modifications

    • Evaluate detergent binding

A high-quality MG320 preparation should demonstrate >95% purity by SDS-PAGE, monodispersity by DLS (PDI<0.2), and a uniform particle distribution by negative stain EM. Any deviation from these criteria may indicate heterogeneity that could impact downstream structural or functional studies.

How can I develop antibodies against MG320 for research applications?

Developing effective antibodies against membrane proteins like MG320 requires specialized approaches:

  • Antigen design strategies:

    • Full-length protein in detergent micelles or nanodiscs

    • Hydrophilic extramembrane domains

    • Synthetic peptides corresponding to predicted extracellular loops

    • Recombinant fragments excluding transmembrane regions

  • Immunization protocols:

    • Multiple host species (rabbit, mouse, chicken)

    • DNA immunization followed by protein boosting

    • Adjuvant selection critical for membrane protein antigens

    • Consider Prime-Boost strategies with different antigen formats

  • Antibody validation methods:

    • Western blotting against recombinant protein and native M. genitalium lysates

    • Immunofluorescence microscopy to confirm surface localization

    • Flow cytometry with intact bacteria

    • Immunoprecipitation followed by mass spectrometry

  • Monoclonal vs. polyclonal considerations:

    • Monoclonals provide specificity for defined epitopes

    • Polyclonals offer broader epitope recognition but potential cross-reactivity

For initial characterization, generating polyclonal antibodies against predicted extracellular domains would provide tools for localization studies and potential neutralization assays similar to those used for other M. genitalium proteins .

What is the potential of MG320 as a diagnostic biomarker for M. genitalium infection?

Evaluating MG320 as a diagnostic biomarker involves several research directions:

  • Expression analysis during infection:

    • Transcriptomic studies to determine expression levels during different stages of infection

    • Comparison with established diagnostic targets

  • Serological studies:

    • Screening patient sera for anti-MG320 antibodies

    • Determining sensitivity and specificity compared to current diagnostic methods

  • Direct detection methods development:

    • PCR-based detection targeting the MG320 gene

    • Comparison with established nucleic acid amplification tests like the Aptima Mycoplasma genitalium assay

  • Performance evaluation matrix:

Detection MethodSensitivitySpecificityAdvantagesLimitations
PCR targeting MG320To be determinedTo be determinedPotential specificityRequires validation
Anti-MG320 serologyTo be determinedTo be determinedNon-invasivePersistence after clearance
MG320 protein detectionTo be determinedTo be determinedDirect evidenceLow abundance challenge
Current CE/IVD AMG assay99.13-100%99.57-99.96%High performanceNot MG320-specific

Current molecular diagnostics for M. genitalium like the CE/IVD Aptima Mycoplasma genitalium assay demonstrate excellent sensitivity (99.13-100%) and specificity (99.57-99.96%) , setting a high benchmark for any new diagnostic target. Additionally, assessment of antibiotic resistance markers would be essential given the high prevalence of resistance in M. genitalium (41.4% for azithromycin) .

How can MG320 be targeted for therapeutic development against M. genitalium infections?

Developing therapeutics targeting MG320 would involve:

  • Target validation studies:

    • Confirm essentiality through gene knockout/knockdown

    • Demonstrate role in pathogenesis as described in previous sections

  • Therapeutic antibody development:

    • Identify neutralizing epitopes on extracellular domains

    • Engineer antibodies with enhanced binding and neutralizing capacity

    • Similar to approaches used for other bacterial surface proteins

  • Small molecule inhibitor screening:

    • Develop binding or functional assays suitable for high-throughput screening

    • Virtual screening against computational models of MG320

    • Fragment-based drug discovery approaches

  • Peptide inhibitor design:

    • Identify peptides that competitively inhibit MG320-host interactions

    • Peptide stapling or other stabilization methods to enhance bioavailability

  • Immunotherapeutic approaches:

    • Vaccine development using recombinant MG320 or domains

    • Evaluation of protective immunity in animal models

Given the increasing antimicrobial resistance in M. genitalium (41.4% resistance to azithromycin and 6.6% to moxifloxacin) , novel therapeutic approaches targeting virulence factors like MG320 could provide alternative treatment strategies that avoid selection pressure on essential cellular functions.

What techniques can I use to study the dynamic interactions of MG320 in living systems?

Studying the dynamics of MG320 in living systems requires sophisticated imaging and molecular techniques:

  • Live cell imaging approaches:

    • Fluorescent protein fusions if MG320 function is preserved

    • Site-specific labeling with small fluorescent tags

    • Super-resolution microscopy (STORM, PALM) for nanoscale localization

  • Single-molecule tracking:

    • Quantum dot labeling of MG320 on bacterial surface

    • Track movement during host cell interaction

  • FRET-based interaction studies:

    • Detect protein-protein interactions in real-time

    • Measure conformational changes during binding events

  • Optogenetic control:

    • Light-inducible protein modifications to control MG320 function

    • Study temporal aspects of MG320-mediated processes

  • Intravital microscopy:

    • Visualize M. genitalium-host interactions in animal models

    • Track tissue colonization patterns

These advanced techniques would provide insights into the temporal and spatial dynamics of MG320 during the infection process, similar to studies conducted with other bacterial adhesins and virulence factors.

How does MG320 compare to similar proteins in other Mycoplasma species?

A comparative analysis of MG320 with homologs in other Mycoplasma species reveals important evolutionary relationships:

  • Sequence homology analysis:

    • BLAST and HHpred searches against mycoplasma genomes

    • Multiple sequence alignment to identify conserved domains and motifs

    • Phylogenetic tree construction to establish evolutionary relationships

  • Structural comparison:

    • Homology modeling based on solved structures of related proteins

    • Prediction of conserved structural features

    • Identification of species-specific variations

  • Functional domain conservation:

    • Analysis of selection pressure on different protein regions

    • Identification of highly conserved residues likely critical for function

    • Variable regions potentially involved in host specificity

Based on preliminary analysis, MG320 shows structural similarities to membrane proteins in other genital mycoplasmas, with conserved transmembrane domains but variable extracellular regions. This pattern is consistent with proteins involved in host-pathogen interactions, where conserved domains maintain core functions while variable regions adapt to host-specific targets.

The evolutionary conservation pattern of MG320 suggests it may play a role similar to other characterized M. genitalium proteins like MG309, which activates NF-κB via TLR2/6 , or MgPa, which promotes cell proliferation .

How can I investigate the potential role of MG320 in antibiotic resistance?

While MG320 is not directly implicated in antibiotic resistance mechanisms, investigating potential indirect roles would involve:

  • Expression analysis during antibiotic exposure:

    • Transcriptomic and proteomic profiling of resistant vs. susceptible strains

    • Quantification of MG320 expression in response to antibiotic stress

  • Membrane composition studies:

    • Evaluate whether MG320 influences membrane properties that affect drug permeability

    • Lipidomic analysis of membrane microdomain composition

  • Drug efflux assays:

    • Determine if MG320 contributes to efflux pump function

    • Compare efflux activity in wild-type vs. MG320-deficient strains

  • Biofilm formation assessment:

    • Investigate MG320's role in potential biofilm formation

    • Evaluate antibiotic tolerance in biofilms with and without MG320

Given the high prevalence of resistance to first-line (azithromycin, 41.4%) and second-line (moxifloxacin, 6.6%) antibiotics in M. genitalium , understanding the potential contribution of membrane proteins like MG320 to resistance mechanisms could inform new therapeutic strategies.

What are the most promising future research directions for MG320?

Based on current knowledge of M. genitalium pathogenesis and the properties of MG320, several research directions show particular promise:

  • Structural biology approaches:

    • High-resolution structure determination to guide targeted drug design

    • Structure-function relationship studies to identify critical domains

  • Host-pathogen interaction studies:

    • Identification of specific host receptors or binding partners

    • Elucidation of signaling pathways activated upon MG320 engagement

  • Immunomodulatory functions:

    • Investigation of MG320's potential role in immune evasion or modulation

    • Comparison with known immunomodulatory proteins like MG309

  • Therapeutic targeting:

    • Development of MG320-specific inhibitors or neutralizing antibodies

    • Evaluation in appropriate infection models

  • Diagnostic applications:

    • Development of MG320-based detection methods for improved diagnosis

    • Correlation of MG320 expression with clinical outcomes

Future research should particularly focus on determining whether MG320, like other M. genitalium proteins (MgPa and MG309), plays a role in modulating host cell functions such as proliferation or inflammatory responses , as these represent potential intervention points for novel therapeutics.

What are the current limitations in MG320 research and how can they be addressed?

Current limitations in MG320 research include:

  • Limited genetic tools for M. genitalium:

    • Development of improved genetic manipulation systems

    • CRISPR-based approaches adapted for mycoplasma

    • Conditional expression systems for essential genes

  • Challenges in membrane protein expression and purification:

    • Optimization of expression systems specifically for mycoplasma membrane proteins

    • Development of detergent-free extraction methods

    • Exploration of cell-free expression systems

  • Lack of structural information:

    • Implementation of advanced structural biology techniques for membrane proteins

    • Integration of computational and experimental approaches

    • Focus on soluble domains as initial targets

  • Difficulties in establishing physiologically relevant infection models:

    • Development of 3D tissue culture systems that better mimic the genital tract

    • Improvement of animal models that recapitulate human infection

    • Organoid-based approaches for studying host-pathogen interactions

  • Limited understanding of MG320's role in pathogenesis:

    • Comprehensive functional screening approaches

    • Systems biology methods to place MG320 in broader pathogenesis networks

    • Comparative studies with better-characterized mycoplasma proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.