Recombinant Mycoplasma genitalium Uncharacterized protein MG406 (MG406)

Shipped with Ice Packs
In Stock

Description

Mycoplasma genitalium Background

Mycoplasma genitalium is a sexually-transmitted bacterial pathogen that persists in patients through adherence to cells via matrix glycoproteins and evasion of host antibodies . As one of the smallest known self-replicating organisms, M. genitalium has garnered significant research interest due to its minimal genome and its role as a human pathogen. The organism employs specialized adhesion proteins, primarily MgpB and MgpC, which contain both variable and conserved regions that contribute to cell adherence and immune evasion .

MG406 Protein Overview

MG406 is classified as an uncharacterized protein encoded by the MG406 gene in Mycoplasma genitalium strain ATCC 33530 / G-37 / NCTC 10195 . Despite being identified in the M. genitalium genome, the specific biological function of MG406 remains largely unknown, hence its designation as "uncharacterized." The recombinant form of this protein has been produced to facilitate research into its structure, function, and potential role in M. genitalium pathogenesis. The UniProt identification number for MG406 is Q49431, providing a standardized reference for this protein in biological databases .

Physicochemical Properties

While detailed structural studies on MG406 appear limited in the available research, analysis of its amino acid sequence reveals several notable characteristics. The protein contains multiple hydrophobic regions interspersed with charged residues, suggesting possible membrane interaction capabilities . The presence of multiple phenylalanine (F) and leucine (L) residues contributes to its hydrophobic nature, while lysine (K) and arginine (R) residues provide positively charged regions that may participate in molecular interactions.

Expression Systems

Recombinant MG406 is typically expressed in Escherichia coli expression systems, which provide an efficient platform for bacterial protein production . The recombinant protein is commonly produced with an N-terminal histidine (His) tag to facilitate purification and detection. The His tag consists of multiple histidine residues that have high affinity for metal ions, enabling purification through immobilized metal affinity chromatography (IMAC) .

Purification and Quality Control

The purification process for recombinant MG406 typically employs affinity chromatography techniques that capitalize on the His-tag's metal-binding properties. After expression in E. coli, the protein undergoes purification to remove host cell proteins and other contaminants. Quality control measures include SDS-PAGE analysis, with commercially available recombinant MG406 preparations typically achieving greater than 90% purity .

Reconstitution Protocols

Recombinant MG406 is typically supplied as a lyophilized powder that requires reconstitution before use. The recommended reconstitution protocol involves:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (final concentration 5-50%) for long-term storage

  4. Aliquoting for storage at -20°C/-80°C to minimize freeze-thaw cycles

These protocols ensure that the reconstituted protein maintains its structural integrity and potential biological activity for experimental applications.

Current Research Applications

While specific research applications of MG406 are not extensively documented in the available literature, recombinant proteins from Mycoplasma genitalium generally serve important functions in various research contexts. These applications may include:

  1. Structural studies to determine protein conformation and domains

  2. Immunological research to investigate host-pathogen interactions

  3. Development of diagnostic tools for M. genitalium infections

  4. Investigation of potential therapeutic targets

The recombinant form of MG406 provides researchers with a standardized tool for investigating this protein's properties and potential functions in M. genitalium biology.

Potential Significance in Pathogenesis

As an uncharacterized protein from M. genitalium, MG406 may play a role in the organism's pathogenic mechanisms. M. genitalium is known to persist in patients through adherence to cells and evasion of host antibodies . While the major adherence proteins MgpB and MgpC have been characterized, other proteins like MG406 may contribute to the organism's survival and pathogenicity through yet undiscovered mechanisms.

Research on M. genitalium proteins has shown that some conserved regions are highly immunogenic and that antibodies to these regions can inhibit bacterial attachment and promote bacterial killing in vitro . Further investigation of MG406 may reveal similar immunogenic properties or other functions relevant to M. genitalium pathogenesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
MG406; Uncharacterized protein MG406
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG406
Target Protein Sequence
MLPLPFAVLNSLSVLRLASFFASLKNVKKQKAVSFFAFFFTARYLIYLIPVIISFVVTPS IFNTIATIISTLFFPILNLVLSFVWLPLEYFFINLISKSKRKHVATGDSFKRN
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_406

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mycoplasma genitalium and why is studying its uncharacterized proteins important?

Mycoplasma genitalium is an emerging sexually transmitted pathogen associated with non-gonococcal urethritis in men and cervicitis, endometritis, and pelvic inflammatory disease in women . With one of the smallest genomes of any self-replicating organism, M. genitalium represents an ideal model for studying minimal gene sets required for cellular life .

Studying uncharacterized proteins like MG406 is crucial because:

  • Each protein in M. genitalium's minimal genome likely serves an essential function

  • Understanding novel proteins may reveal unique mechanisms of pathogenesis

  • The organism's small genome (approximately 580kb) means uncharacterized proteins represent a significant portion of its proteome

  • Identifying new virulence factors could lead to targeted therapeutic approaches

M. genitalium possesses multiple virulence mechanisms including adhesion proteins (MgPa protein and P32), enzymatic activities (glyceraldehyde-3-phosphate dehydrogenase), and various nucleases that contribute to pathogenesis . Uncharacterized proteins may participate in these known pathways or represent entirely novel virulence mechanisms.

What approaches should be used for initial bioinformatic characterization of MG406?

Initial characterization of MG406 should involve comprehensive bioinformatic analysis:

  • Sequence analysis:

    • BLAST searches against protein databases to identify homologs

    • Multiple sequence alignment with orthologous proteins from related mycoplasmas

    • Domain prediction using tools like PFAM, SMART, or CDD

    • Analysis of physicochemical properties (molecular weight, pI, hydrophobicity)

  • Structural prediction:

    • Secondary structure prediction

    • 3D structure modeling using homology modeling or ab initio approaches

    • Identification of potential functional motifs and catalytic residues

  • Genomic context analysis:

    • Examination of the MG406 locus and neighboring genes

    • Operon prediction and co-expression analysis

    • Comparative genomics across Mycoplasma species

  • Cellular localization prediction:

    • Signal peptide prediction

    • Transmembrane domain analysis

    • Lipoprotein motif identification similar to that found in MG_186

The complete genome sequence of M. genitalium provides the foundation for these analyses, with systems designed to identify important genomic fragments and open reading frames (ORFs) .

How does the evolutionary conservation of MG406 compare to characterized M. genitalium proteins?

Evolutionary conservation analysis of MG406 should include:

  • Ortholog identification across bacterial species:

    • Special focus on other minimal genome organisms

    • Analysis of conservation within the Mycoplasmataceae family

    • Comparison with more distantly related bacteria

  • Selective pressure analysis:

    • Calculation of dN/dS ratios to determine evolutionary constraints

    • Identification of positively and negatively selected residues

    • Comparison with known virulence factors like adhesion proteins

  • Structural conservation assessment:

    • Analysis of conserved domains even in the absence of high sequence similarity

    • Identification of conserved catalytic residues or binding motifs

    • Comparison with characterized proteins like MG_186 nuclease

  • Comparative analysis table:

Analysis MetricMG406MgPa AdhesinMG_186 NucleaseReference
Distribution across Mycoplasma species[To be determined]Highly conservedModerately conserved
Selective pressure (dN/dS)[To be determined]Variable in antigenic regionsConserved in catalytic domain
Structural conservation[To be determined]Conserved terminal tip structureConserved Ca²⁺-binding motifs
Functional domain conservation[To be determined]Adhesion domainsNuclease motif

What are the optimal cloning strategies for expressing recombinant MG406?

When designing expression strategies for MG406, researchers should consider:

  • Codon optimization and UGA correction:

    • M. genitalium uses UGA to encode tryptophan rather than as a stop codon

    • All UGA codons must be converted to standard tryptophan UGG codons

    • This approach was successfully used for MG_186 expression

  • Expression vector selection:

    • pET system for high-level E. coli expression

    • pGEX for GST fusion to enhance solubility

    • pMAL for MBP fusion to improve folding

  • Affinity tag placement:

    • N-terminal vs. C-terminal tags considering protein structure

    • TEV or PreScission protease sites for tag removal

    • Dual tagging strategies for difficult proteins

  • Expression host considerations:

    • E. coli BL21(DE3) for standard expression

    • Rosetta or OrigamiB strains for proteins with rare codons or disulfide bonds

    • Consideration of higher eukaryotic hosts for complex proteins

The experimental design should incorporate lessons from successful expression of other M. genitalium proteins: "We cloned, UGA corrected, expressed, purified, and demonstrated that recombinant MG_186 (rMG_186) exhibits nuclease activity..." .

What expression and purification challenges are anticipated for MG406?

Based on experience with other Mycoplasma proteins, researchers should prepare for these challenges:

  • Protein solubility issues:

    • Fusion partners (GST, MBP, SUMO) may be necessary

    • Optimization of induction conditions (temperature, IPTG concentration)

    • Specialized lysis buffers containing solubility enhancers

  • Protein stability concerns:

    • Addition of protease inhibitors during purification

    • Buffer optimization with stabilizing agents

    • Storage condition determination

  • Purification strategy development:

    • Multi-step purification incorporating:

      • Affinity chromatography (IMAC for His-tagged protein)

      • Ion exchange chromatography

      • Size exclusion chromatography

    • On-column refolding for inclusion body proteins

  • Membrane association determination:

    • Triton X-114 phase separation to assess lipid association

    • Membrane fractionation techniques similar to those used for MG_186

    • Detergent screening if MG406 is membrane-associated

The successful purification of other M. genitalium proteins provides a roadmap: "Mycoplasma membrane fractionation and Triton X-114 phase separation showed that MG_186 was a membrane-associated lipoprotein, and electron microscopy revealed its surface membrane location" .

How should researchers design functional assays to characterize MG406?

Without prior knowledge of MG406's function, researchers should implement a systematic approach:

  • General biochemical activity screening:

    • Test for common enzymatic activities (nuclease, protease, glycosidase)

    • Substrate profiling using activity-based probes

    • Metal ion dependence analysis (similar to Ca²⁺ dependence of MG_186)

  • Host interaction assays:

    • Binding assays with host cellular components

    • Effects on host cell morphology and viability

    • Co-localization studies in infected cells

  • Structural characterization:

    • Circular dichroism for secondary structure assessment

    • Thermal shift assays for stability and ligand binding

    • X-ray crystallography or cryo-EM for detailed structure

  • Cellular assays based on M. genitalium pathogenesis:

    • Effects on host cell nuclei (as observed with MG_186)

    • Impact on cytoskeletal rearrangements

    • Modulation of host immune responses

Functional characterization should consider M. genitalium's known pathogenic mechanisms: "Incubation of purified human endometrial cell nuclei with rMG_186 resulted in DNA degradation and morphological changes typical of apoptosis" .

How might MG406 contribute to M. genitalium pathogenesis?

To investigate MG406's potential role in pathogenesis, researchers should consider:

  • Host cell interaction studies:

    • Incubation of purified recombinant MG406 with human cell lines

    • Assessment of cytopathic effects and cellular responses

    • Comparison with known virulence factors

  • Localization during infection:

    • Determination if MG406 remains bacterial-associated or is secreted

    • Investigation of potential nuclear localization similar to other M. genitalium proteins

    • Examination of temporal expression during different infection phases

  • Immune response evaluation:

    • Analysis of inflammatory responses to purified MG406

    • Assessment of antibody responses in infected individuals

    • Correlation with disease severity in clinical samples

  • Potential mechanisms based on known M. genitalium pathogenesis:

    • Adhesion to host tissues (similar to MgPa protein)

    • Enzymatic activity affecting host cell components (like MG_186 nuclease)

    • Immune evasion through antigenic variation

The search results reveal that other M. genitalium proteins contribute to pathogenesis: "Since M. genitalium has the capacity to invade eukaryotic cells and localize to the perinuclear and nuclear region of parasitized target cells, MG_186 has the potential to provide M. genitalium with the ability to degrade host nucleic acids both as a source of nucleotide precursors for growth and for pathogenic purposes" .

What approaches should be used to investigate MG406's potential interactions with host cells?

Researchers investigating MG406-host interactions should employ:

  • Direct binding assays:

    • Pull-down experiments with host cell lysates

    • Surface plasmon resonance with purified host components

    • ELISA-based binding assays with extracellular matrix proteins

  • Cellular localization studies:

    • Fluorescently labeled MG406 tracking in host cells

    • Co-localization with cellular organelles and structures

    • Time-course studies of protein trafficking

  • Host response assessment:

    • Transcriptomics of MG406-treated host cells

    • Proteomics to identify altered host protein expression

    • Phosphoproteomics to detect modified signaling pathways

  • Comparative analysis with known M. genitalium virulence mechanisms:

    • Comparison with MG_186 nuclease activity on host nuclei

    • Assessment against adhesion mechanisms of MgPa protein

    • Evaluation of immune evasion strategies

Evidence from other M. genitalium proteins suggests potential nuclear interaction: "Our recent evidence suggests that M. genitalium and its protein products are capable of intranuclear localization within infected endometrial cells" .

How can researchers develop antibodies against MG406 for research applications?

Development of specific antibodies against MG406 requires:

  • Antigen design strategies:

    • Full-length recombinant protein approach

    • Synthetic peptide selection based on:

      • Predicted surface exposure

      • Antigenicity algorithms

      • Lack of similarity to human proteins

    • Multiple epitope targeting for comprehensive detection

  • Antibody production methodologies:

    • Polyclonal antibody generation in rabbits or goats

    • Monoclonal antibody development using hybridoma technology

    • Recombinant antibody engineering through phage display

  • Validation approaches:

    • Western blot verification against recombinant and native protein

    • Immunofluorescence specificity testing

    • Flow cytometry for surface-exposed epitopes

    • Cross-reactivity assessment with related Mycoplasma proteins

  • Application-specific optimization:

    • Affinity purification of antibodies

    • Conjugation for different detection methods

    • Functional blocking assay development

Properly validated antibodies would enable critical applications including: tracking MG406 during infection, immunoprecipitation for interaction studies, and detection in clinical samples for epidemiological research.

How prevalent is M. genitalium infection and what implications does this have for MG406 research?

Understanding the epidemiological context is crucial for MG406 research:

  • Global prevalence patterns:

    • M. genitalium prevalence ranges from approximately 1% in general populations to over 50% in high-risk groups

    • Prevalence varies significantly by geographic region, age, and risk factors

    • Higher rates observed in younger populations and those with multiple sexual partners

  • Demographic distribution:

Age GroupFemale Prevalence (%)Male Prevalence (%)
14-17 yrs30.0 (18.7-45.4)No data
18-20 yrs25.0 (18.6-32.8)12.5 (5.9-24.7)
21-30 yrs13.3 (9.4-18.6)24.1 (18.9-30.2)
31-40 yrs9.6 (4.7-18.5)14.7 (8.4-24.4)
41-50 yrs2.9 (0.5-14.9)6.1 (2.1-16.5)
51-60 yrs6.3 (1.1-28.3)3.4 (0.6-17.2)

Table data from referenced study

  • Coinfection patterns:

    • M. genitalium is frequently found alongside other STIs

    • Coinfection rates with C. trachomatis, N. gonorrhoeae, and T. vaginalis vary by population

    • These patterns suggest potential interaction between pathogens

  • Implications for MG406 research:

    • High prevalence justifies investment in protein characterization

    • Age-specific patterns may indicate different roles in pathogenesis

    • Coinfection patterns may suggest synergistic mechanisms

The prevalence data emphasizes the public health importance of understanding M. genitalium proteins: "M. genitalium prevalence rates of approximately 1% in a screening population and ranging from 9% to >50% in populations at high risk for sexually transmitted infections" .

How might MG406 contribute to antimicrobial resistance mechanisms in M. genitalium?

Investigation of potential antimicrobial resistance connections:

  • Genomic analysis for resistance associations:

    • Examination of MG406 gene presence/absence in resistant isolates

    • Analysis of genetic variations in MG406 between susceptible and resistant strains

    • Assessment of potential horizontal gene transfer markers

  • Functional assessment for resistance mechanisms:

    • Evaluation of potential drug efflux capabilities

    • Investigation of antibiotic modification/inactivation activity

    • Analysis of potential protective functions against antimicrobial compounds

  • Expression studies in resistant strains:

    • Comparison of MG406 expression levels between susceptible and resistant isolates

    • Analysis of MG406 regulation in response to antibiotic exposure

    • Correlation of expression with minimum inhibitory concentrations

  • Therapeutic target evaluation:

    • Assessment of MG406 as a novel drug target

    • Potential for antibody-based therapeutic approaches

    • Development of peptide inhibitors if function is established

This research direction is particularly relevant given growing concerns about treatment options: "Mycoplasma genitalium, its management still remains an enigma for clinicians worldwide" .

What potential diagnostic applications might emerge from MG406 characterization?

MG406 characterization could lead to several diagnostic applications:

  • Molecular diagnostic development:

    • PCR primer design targeting the MG406 gene

    • Assessment of genetic conservation across clinical isolates

    • Multiplex assay development incorporating MG406 detection

  • Immunodiagnostic possibilities:

    • Evaluation of MG406 as a serological marker in infected individuals

    • Development of rapid antigen detection tests

    • Assessment of antibody responses as indicators of active infection

  • Functional biomarker potential:

    • If enzymatic activity is established, development of activity-based diagnostics

    • Correlation of MG406 levels/activity with disease severity

    • Differential diagnostic applications for distinguishing M. genitalium from other STIs

  • Comparison with current diagnostic approaches:

    • Evaluation against established PCR and transcription-mediated amplification methods

    • Assessment of sensitivity and specificity compared to existing targets

    • Determination of added value in combination with existing diagnostics

Current diagnostic methods primarily rely on nucleic acid amplification tests: "The use of nucleic acid amplification tests (NAATs) employing PCR for detection of M. genitalium genomic DNA targets and transcription-mediated amplification (TMA) for detection of M. genitalium 16S rRNA has increased our understanding of the epidemiology" .

What structural biology approaches are most appropriate for MG406 characterization?

Comprehensive structural characterization of MG406 should include:

  • Primary structure analysis:

    • Mass spectrometry for exact mass determination

    • N-terminal sequencing to confirm recombinant protein integrity

    • Post-translational modification analysis

  • Secondary structure determination:

    • Circular dichroism spectroscopy for α-helix and β-sheet content

    • Fourier-transform infrared spectroscopy as complementary analysis

    • Differential scanning calorimetry for thermal stability

  • Tertiary structure elucidation:

    • X-ray crystallography as the gold standard approach

    • Cryo-electron microscopy for difficult-to-crystallize forms

    • NMR spectroscopy for smaller domains and dynamic regions

    • Small-angle X-ray scattering for solution structure

  • Structure-function relationship studies:

    • Site-directed mutagenesis of predicted functional residues

    • Hydrogen-deuterium exchange mass spectrometry for dynamic regions

    • Molecular dynamics simulations to predict functional movements

These approaches should be informed by successful structural characterization of other M. genitalium proteins, focusing on potential functional motifs similar to those identified in characterized proteins like MG_186 .

How should researchers investigate potential enzymatic activities of MG406?

A systematic approach to enzymatic characterization should include:

  • Broad-spectrum activity screening:

    • Test for common enzymatic activities (hydrolase, transferase, etc.)

    • Substrate profiling using activity-based probes

    • High-throughput colorimetric or fluorescent assays

  • Focused assays based on bioinformatic predictions:

    • Design specific assays based on predicted domains

    • Test cofactor requirements (ions, organic molecules)

    • Determine optimal reaction conditions (pH, temperature, salt)

  • Kinetic characterization:

    • Determination of key kinetic parameters (Km, Vmax, kcat)

    • Inhibitor screening and characterization

    • Assessment of allosteric regulation

  • Comparison with characterized M. genitalium enzymes:

    • Investigation of potential nuclease activity (like MG_186)

    • Assessment of glyceraldehyde-3-phosphate dehydrogenase-like activity

    • Evaluation of methionine sulfoxide reductase-like functions

This systematic approach mirrors successful characterization of other M. genitalium proteins: "Biochemical characterization indicated that Ca²⁺ alone enhances its activity, which was inhibited by divalent cations, such as Zn²⁺ and Mn²⁺. Chelating agents EGTA and EDTA also inhibited nuclease activity" .

How might characterization of MG406 contribute to new therapeutic approaches?

Understanding MG406 could lead to novel therapeutic strategies:

  • Direct targeting approaches:

    • Development of small molecule inhibitors if enzymatic function is identified

    • Structure-based drug design following crystal structure determination

    • Peptide inhibitors targeting key protein-protein interactions

  • Immunotherapeutic possibilities:

    • Evaluation as a vaccine candidate

    • Development of therapeutic antibodies

    • Assessment for passive immunization approaches

  • Diagnostic-therapeutic combinations:

    • Theranostic applications combining detection and targeting

    • Point-of-care testing linked to immediate treatment decisions

    • Personalized therapy based on MG406 variant detection

  • Considerations based on M. genitalium infection patterns:

    • Targeting based on tissue tropism and cellular localization

    • Consideration of coinfection patterns for combination therapies

    • Addressing potential role in antimicrobial resistance

Novel therapeutic approaches are urgently needed given current challenges: "M. genitalium's fastidious nature and slow growth have been a major hurdle in the diagnosis and in vitro antibiotic susceptibility studies" .

What cell-based assays would best evaluate MG406's effects on host cells?

To comprehensively assess MG406's impact on host cells:

  • Cytopathic effect analysis:

    • Live-cell imaging of MG406-treated cells

    • Assessment of morphological changes

    • Quantification of cell death parameters

    • Comparison with effects observed for MG_186

  • Cellular function assays:

    • Proliferation and metabolic activity measurement

    • Migration and invasion capacity assessment

    • Cell cycle analysis and DNA integrity evaluation

    • Gene expression profiling

  • Mechanistic investigations:

    • Apoptosis pathway analysis

    • DNA damage response assessment

    • Stress response evaluation

    • Cytoskeletal integrity analysis

  • Cell type-specific responses:

    • Comparison of effects on reproductive tract epithelial cells

    • Assessment of immune cell responses

    • Evaluation of tissue-specific cell models

    • 3D organoid models for more physiologically relevant testing

Cell-based approaches should consider known M. genitalium effects: "Immunofluorescence analysis of rMG_186-treated nuclei indicated that morphological changes were linked to the disintegration of lamin and the internalization of rMG_186" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.