Recombinant Mycoplasma genitalium Uncharacterized protein MG432 (MG432)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant MG432 is synthesized via heterologous expression in E. coli, followed by affinity chromatography using the His tag for purification . Critical protocols include:

  • Storage: Long-term storage at -20°C/-80°C; short-term aliquots at 4°C .

  • Reconstitution: Recommended in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol to prevent aggregation .

  • Stability: Sensitive to repeated freeze-thaw cycles, necessitating single-use aliquoting .

Research Applications

While MG432’s biological role is uncharacterized, its recombinant form is utilized in:

  • Antigenic Studies: Investigating immune responses to M. genitalium infections .

  • Pathogenicity Screening: Exploring interactions with host cells, analogous to characterized adhesins like MgPa .

  • Structural Biology: Analyzing conserved domains for homology modeling .

Notably, homologs of MG432 exist in other Mycoplasma species (e.g., M. pneumoniae MPN_630), suggesting potential functional conservation .

Comparative Analysis with Other M. genitalium Proteins

MG432 contrasts with well-studied M. genitalium proteins:

ProteinFunctionRole in Pathogenicity
MG312Cytadherence, gliding motilityTerminal organelle assembly
MgPaHost cell adhesionPromotes urothelial cell proliferation
MG432UncharacterizedHypothesized involvement in immune evasion

The lack of functional data for MG432 highlights a gap in understanding M. genitalium virulence mechanisms .

Challenges and Future Directions

Key limitations and research needs include:

  • Functional Characterization: Elucidating MG432’s role in bacterial adhesion, immune evasion, or metabolic pathways .

  • Antimicrobial Resistance (AMR): Linking MG432 to AMR mechanisms, as seen in macrolide-resistant M. genitalium strains .

  • Therapeutic Target Potential: Assessing its viability for vaccine development or drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MG432; Uncharacterized protein MG432
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG432
Target Protein Sequence
MKDKNIKISGNFVRIHLSGSFLKFQSIYNLKKLYLQLVILTIVAFFWGLLGVIFVQFSGL YDIGMASISQGLARLVNFFITSQNINVDSATIFNAIFWLTQILFNVPFFIFGWFKISKKF TLLTLYFVAVSNLFGFFFSYIPGIDNFFLFANLTTAKDGGFENLINEKGVQLIFWEKSAE KQVSLLFYGLIWGFLQAVFYSVILIIDASTGGLDFLAFWYSEKKYKDIGGILMLINTVSF IIGYVIGTYLTGSLSVQSYVGDDKHQPFGVAFFLSPNLVFTLLMNIVLGLFTSFYFPKYQ FVKVEVYGKHIEKIRNYLLDNQQWFSITMFEAEGGYSRQKTQVLVTNCLLIKAAKLLEDV RKFDRDALFSITFIKKLDGYIYDRRTNKQTKHGTENKS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MG432 and what are its basic characteristics?

MG432 is an uncharacterized protein from Mycoplasma genitalium with a full length of 398 amino acids. The protein sequence indicates multiple hydrophobic domains suggesting potential membrane association. The recombinant version commonly used in research contains an N-terminal His-tag and is expressed in E. coli expression systems . This protein remains functionally uncharacterized, but its conservation in M. genitalium suggests biological significance. The amino acid sequence shows several transmembrane domains and potential functional motifs that may relate to membrane transport or signaling functions .

How should recombinant MG432 protein be stored and reconstituted for experimental use?

Recombinant MG432 protein is typically supplied as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For optimal stability and activity, researchers should:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • Briefly centrifuge the vial before opening to ensure contents are at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles as these can compromise protein integrity

  • Store working aliquots at 4°C for up to one week

For long-term storage, aliquoting is necessary to minimize freeze-thaw damage. The presence of trehalose in the storage buffer helps maintain protein stability during freeze-thaw cycles by preventing protein denaturation and aggregation.

What expression systems are used for producing recombinant MG432 protein?

Recombinant MG432 protein is predominantly expressed in E. coli expression systems . The process typically involves:

  • Cloning the MG432 gene (with or without codon optimization) into a suitable expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Transforming the construct into an E. coli expression strain

  • Inducing expression under optimized conditions (temperature, inducer concentration, duration)

  • Purifying using affinity chromatography (typically Ni-NTA for His-tagged proteins)

  • Verifying purity using SDS-PAGE (>90% purity is standard for research applications)

This bacterial expression system provides cost-effective production of recombinant MG432 with sufficient yields for most research applications, though mammalian expression systems might be considered for studies requiring specific post-translational modifications.

How can researchers design experiments to elucidate the function of uncharacterized MG432 protein?

Determining the function of an uncharacterized protein like MG432 requires a multi-faceted approach:

  • Bioinformatic prediction: Perform comprehensive sequence analysis using tools like BLAST, Pfam, and TMHMM to identify conserved domains, structural motifs, and potential homologs in other species.

  • Localization studies: Use fluorescently-tagged MG432 in cell culture systems to determine subcellular localization, which can provide functional clues.

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with anti-His antibodies

    • Yeast two-hybrid screening

    • Proximity labeling approaches (BioID, APEX)

  • Functional knockdown/knockout:

    • Generate MG432 deletion mutants in M. genitalium (considering its potential relationship with MG428, a known regulator)

    • Assess phenotypic changes in growth, adhesion, recombination frequency, and antigenicity

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • Circular dichroism to assess secondary structure elements

The lack of characterized function makes this protein particularly interesting as a research target, potentially offering insights into unique aspects of M. genitalium biology.

What is the potential relationship between MG432 and the antigenic variation mechanisms in M. genitalium?

While direct evidence linking MG432 to antigenic variation is not established in the provided literature, researchers might explore potential connections through:

  • Expression correlation analysis: Determine if MG432 expression correlates with known recombination events or antigenic variation in the mgpB and mgpC genes .

  • Protein interaction studies: Investigate whether MG432 physically interacts with key recombination proteins in M. genitalium, particularly:

    • RecA (available in three distinct isoforms in M. genitalium)

    • RuvA and RuvB (required for DNA strand exchange)

    • RecU (required for resolution of DNA recombination intermediates)

    • MG428 (sigma factor regulating recombination)

  • Recombination frequency assessment: Generate MG432 mutants and measure the frequency of mgpB/mgpC recombination with MgPar regions, comparing to the established rate of >1.25 × 10⁻⁴ events per genome per generation .

Understanding this potential relationship would be significant as M. genitalium's antigenic variation mechanism allows it to evade host immune responses, contributing to persistent infection and complicating treatment approaches.

What analytical methods are most effective for studying protein-protein interactions involving MG432?

When investigating potential interaction partners of MG432, researchers should consider:

  • Co-immunoprecipitation (Co-IP):

    • Leverage the His-tag on recombinant MG432 for pull-down assays

    • Validate interactions using reciprocal Co-IP

    • Analyze pulled-down proteins via mass spectrometry

  • Proximity-dependent labeling:

    • Generate MG432-BioID or MG432-APEX2 fusion proteins

    • Express in relevant cellular contexts

    • Identify proximal proteins through streptavidin pull-down and MS analysis

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MG432 on a sensor chip

    • Test binding kinetics with candidate interacting proteins

    • Determine association/dissociation constants

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use chemical crosslinkers to capture transient interactions

    • Digest crosslinked complexes and analyze by MS

    • Identify interaction interfaces through crosslinked peptides

Each method offers distinct advantages, with Co-IP being most accessible but proximity labeling potentially revealing weaker or transient interactions that might be missed by traditional approaches.

How should researchers design controls when studying the function of MG432 in M. genitalium pathogenesis?

Robust control design is critical when investigating an uncharacterized protein:

  • Negative controls:

    • Empty vector expression systems

    • Irrelevant His-tagged protein of similar size

    • Heat-denatured MG432 protein

    • Isogenic MG432 deletion mutants

  • Positive controls:

    • Well-characterized M. genitalium proteins (e.g., MgpB, MgpC)

    • Known interacting proteins from the RecA recombination pathway

  • Complementation controls:

    • Phenotype rescue experiments in MG432 knockout strains

    • Partial constructs to identify functional domains

  • Species-specific controls:

    • Comparison with orthologous proteins from related Mycoplasma species

    • Heterologous expression in model systems with and without M. genitalium background

When publishing results, researchers should systematically report all controls utilized and their outcomes to establish confidence in the functional characterization of this previously uncharacterized protein.

What are the challenges in studying MG432 in the context of antimicrobial resistance mechanisms?

Investigating MG432's potential role in antimicrobial resistance presents several methodological challenges:

  • Correlation with resistance phenotypes:

    • M. genitalium shows increasing resistance to macrolides and fluoroquinolones

    • Researchers must differentiate between established resistance mechanisms (e.g., 23S rRNA A2058T mutation, ParC Ser83Ile mutation) and potential MG432 contributions

  • Expression analysis challenges:

    • Comparing MG432 expression levels between susceptible and resistant strains

    • Controlling for strain background effects beyond resistance determinants

  • Functional validation:

    • Creating isogenic strains differing only in MG432 status

    • Overcoming difficulties in genetic manipulation of M. genitalium

  • Clinical relevance assessment:

    • Obtaining sufficient clinical isolates for meaningful analysis

    • Correlation with treatment outcomes in clinical settings

Researchers investigating this area should consider implementing systems biology approaches that integrate transcriptomics, proteomics, and functional genomics to comprehensively evaluate MG432's involvement in resistance phenotypes.

What structural biology approaches are most promising for elucidating MG432 function?

Understanding the structure-function relationship of MG432 requires sophisticated approaches:

  • X-ray crystallography:

    • Requires optimization of protein expression, purification, and crystallization conditions

    • May need to remove flexible regions or use truncated constructs to facilitate crystallization

    • Resolution of 2.5Å or better would enable detailed structural analysis

  • Cryo-electron microscopy:

    • Particularly valuable if MG432 exists in larger complexes

    • Can visualize different conformational states

    • Does not require protein crystallization

  • Nuclear Magnetic Resonance (NMR):

    • Useful for studying protein dynamics and ligand interactions

    • Limited by the size of MG432 (398aa may be challenging)

    • Requires isotopic labeling (¹⁵N, ¹³C) during recombinant expression

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides insights into protein dynamics and conformational changes

    • Can identify regions involved in protein-protein interactions

    • Less resolution than crystallography but more accessible technique

  • In silico modeling:

    • Leveraging AlphaFold2 or RoseTTAFold for structure prediction

    • Molecular dynamics simulations to predict functional motions

    • Virtual screening for potential ligands

Combining multiple structural approaches would provide complementary information and increase confidence in functional predictions.

How might MG432 contribute to M. genitalium's unique recombination mechanisms?

M. genitalium employs sophisticated recombination mechanisms despite having a minimal genome. The potential role of MG432 could be explored by:

  • Comparative genomics: Analyzing the conservation of MG432 across strains with varying recombination frequencies, particularly in clinical isolates with different mgpB genotypes .

  • Protein-protein interaction studies: Investigating direct interactions between MG432 and the limited set of recombination proteins in M. genitalium:

    • RecA (especially its unique three isoforms)

    • RuvA/B complex

    • RecU resolvase

    • MG428 sigma factor

  • Transcriptional regulation analysis: Determining if MG432 is part of the MG428 regulon, which controls recombination in M. genitalium .

  • Structural comparisons: Identifying structural similarities between MG432 and known recombination modulators in other minimal genome organisms.

  • Recombination frequency quantification: Measuring mgpB/mgpC recombination rates in the presence of varied MG432 expression levels.

Understanding this relationship could reveal novel regulatory mechanisms for bacterial recombination in organisms with streamlined genomes and potentially identify new therapeutic targets for persistent M. genitalium infections.

How can researchers correlate MG432 expression or variation with clinical outcomes in M. genitalium infections?

Investigating clinical correlations requires careful experimental design:

  • Clinical sample collection protocol:

    • Standardized collection of urogenital specimens from M. genitalium-positive patients

    • Comprehensive patient metadata including treatment history and outcomes

    • Treatment response categorization (clearance, persistence, recurrence)

  • MG432 expression quantification:

    • Development of MG432-specific quantitative PCR assays

    • RNA isolation protocols optimized for clinical specimens

    • Normalization strategies against housekeeping genes

  • Sequence variation analysis:

    • Amplification and sequencing of MG432 from clinical isolates

    • Correlation of sequence variants with:

      • Treatment outcomes

      • Co-occurring resistance mutations in 23S rRNA and ParC

      • mgpB sequence types (e.g., ST159 clone identified in France)

  • Statistical approach:

    • Multivariate analysis to control for confounding factors

    • Longitudinal modeling for treatment response

    • Machine learning algorithms to identify predictive signatures

This approach would help determine whether MG432 has potential as a biomarker for treatment response or virulence in clinical M. genitalium infections.

What methodological approaches can differentiate the function of MG432 from other uncharacterized proteins in the M. genitalium proteome?

Distinguishing the specific function of MG432 requires targeted approaches:

  • Comparative functional genomics:

    • Simultaneous knockout/knockdown of multiple uncharacterized proteins

    • Epistasis analysis to establish genetic relationships

    • Complementation testing between different uncharacterized proteins

  • Protein interactome mapping:

    • Comprehensive protein interaction network analysis

    • Clustering of uncharacterized proteins based on interaction partners

    • Identification of MG432-specific interaction nodes

  • Transcriptional co-regulation analysis:

    • RNA-seq under various conditions (stress, antibiotic exposure)

    • Identification of co-regulated gene clusters

    • Correlation with known functional pathways

  • Phenotypic profiling:

    • High-content imaging of mutant strains

    • Growth curve analysis under varied conditions

    • Host cell interaction phenotypes

  • Evolutionary rate analysis:

    • Comparison of selection pressure on different uncharacterized proteins

    • Identification of conserved versus rapidly evolving regions

    • Correlation with predicted functional importance

This multi-dimensional approach would position MG432's function within the broader context of M. genitalium biology while distinguishing it from other uncharacterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.