Recombinant Mycoplasma genitalium Uncharacterized protein MG441 (MG441)

Shipped with Ice Packs
In Stock

Description

Introduction

Mycoplasma genitalium is a human pathogen with a small genome that causes genitourinary diseases . Due to its limited genetic material, M. genitalium lacks many genes found in other bacteria, including those encoding antioxidants . MG441 is an uncharacterized protein in M. genitalium for which research is ongoing to determine its function.

Characterization of MG441

The function of MG441 has not been fully elucidated. Research suggests the protein is involved in recombination and gene variation of MgpB and MgpC proteins, which are immunodominant . Studies show that MG428 positively regulates the expression of recombination genes, including recA, ruvA, and ruvB .

MG441 and Recombination

MG441 influences genetic variation in M. genitalium . A study showed that overexpressing MG428 (another protein) positively regulates the expression of recombination genes, leading to an increase in mgpBC gene variation . In contrast, cells lacking MG428 were unable to generate variants, despite normal levels of RecA .

Role in Organic Hydroperoxide Resistance

Research indicates that MG_454, another protein in M. genitalium, provides resistance against organic hydroperoxides . A transposon mutant lacking MG_454 expression was sensitive to killing by t-butyl hydroperoxide and cumene hydroperoxide .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements, and we will prioritize development of your specified tag.
Synonyms
MG441; Uncharacterized protein MG441
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG441
Target Protein Sequence
MSVSFLRSKFSLKASVFAFFVLFLFCLKIILVLFRNFGKRFKHFLFNQTSLYLLVRLFQK TEIVWNLIANIHFFIKTQIQNLGIRLSRESISNETFQAVKLFHVNNLGLQEQEVINSKLS DYFCFFKYRNLLFVNW
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Mycoplasma genitalium and why is it significant for protein research?

Mycoplasma genitalium is a sexually transmitted pathogen that can cause a range of reproductive tract diseases in both men and women . It has the smallest known genome of any free-living organism, with only 484 predicted proteins . This minimal genome makes M. genitalium an excellent model organism for studying essential cellular functions and protein characterization. The compact nature of its genome suggests that many of its proteins, including uncharacterized ones like MG441, likely serve essential functions, making them valuable targets for basic research and potential therapeutic development.

How does MG441 fit into the broader context of M. genitalium proteins?

While MG441 is not specifically characterized in the current literature, it represents one of the proteins in the M. genitalium proteome. From genome analysis studies, we know that M. genitalium contains 85 small proteins less than 150 amino acids in length, of which approximately 51 have annotated functions in databases like KEGG and GTOP . Uncharacterized proteins like MG441 are part of the remaining proteins whose functions have not been fully elucidated through sequence homology or experimental verification. These proteins may play crucial roles in the organism's biology and pathogenicity.

What challenges exist in studying uncharacterized bacterial proteins?

The primary challenges in studying uncharacterized proteins like MG441 include:

  • Limited sequence homology to known proteins, making functional prediction difficult

  • Potential cross-reactivity with proteins from related species like M. pneumoniae, complicating specific detection and characterization

  • Difficulties in predicting protein structures accurately, especially for proteins that may function as part of complexes rather than as isolated monomers

  • Challenges in expressing and purifying soluble, correctly folded recombinant proteins for functional studies

What computational methods can be used to predict the structure of uncharacterized proteins like MG441?

Ab initio protein structure prediction methods, such as the TOUCHSTONE procedure, have been successfully applied to small proteins in the M. genitalium genome . This approach is particularly effective for proteins under 150 amino acids in length. The methodology typically involves:

  • Sequence comparison methods like PSI-BLAST and FASTA to search for homologous structures

  • Threading approaches such as PROSPECTOR to predict structural folds

  • Simulation clustering to identify the most likely structural conformations

  • Validation through metrics like root mean square deviation (RMSD) and coverage percentage

The success of these predictions can be evaluated based on the number of clusters obtained, with fewer clusters generally indicating better convergence to the native structure .

What are the key parameters that determine successful structure prediction for M. genitalium proteins?

Based on computational studies of M. genitalium proteins, several parameters significantly impact successful structure prediction:

ParameterDescriptionImpact on Prediction Quality
Contact restraintsPercentage relative to protein lengthHigher percentages (>140%) correlate with better prediction accuracy
Number of clustersDistinct structural conformations from simulationsFewer clusters (≤5) typically indicate better convergence
CoveragePercentage of structure correctly aligned with templateHigher coverage (>87%) indicates more complete structural prediction
Mirror-image structuresTopologically equivalent structures with reversed chiralityCan complicate identification of the true native structure

For the 34 M. genitalium proteins that had high-confidence structural predictions, the average coverage was 87.6% when the minimum RMSD was not more than 1.5Å, with an average contact restraint percentage of 137.6% .

How reliable are computational predictions for previously uncharacterized proteins?

For the 34 M. genitalium proteins with high-confidence structural templates identified through threading, computational predictions demonstrated remarkable accuracy. In all but two cases, at least one of the cluster centroids obtained from simulations had the same fold as the predicted threaded structure with at least 60% coverage . The correlation coefficient between the percentage of contact restraints and the coverage was 0.56, suggesting that more contact restraints generally lead to better convergence to the correct fold .

  • Difficulty in predicting structures of proteins with dangling N- or C-terminal tails

  • Challenges in reproducing two-domain structures when using methods that favor compact, single-domain conformations

  • Occurrence of topological mirror-image structures that share the same local substructures but differ in global assembly

What expression systems are recommended for producing recombinant M. genitalium proteins?

While the search results don't specifically address expression systems for M. genitalium proteins, general approaches for recombinant protein expression would apply:

  • Bacterial expression systems (E. coli): Generally provide high yields but may struggle with proper folding of some proteins

  • Yeast expression systems: Offer eukaryotic post-translational modifications and often better solubility

  • Insect or mammalian cell systems: Provide more complex post-translational modifications when needed for functional studies

For membrane-associated proteins, which are common in mycoplasmas, specialized expression systems that facilitate proper membrane insertion may be required. The choice of expression system should be guided by the predicted properties of the target protein and the intended downstream applications.

What serological approaches can be used to study immune responses to M. genitalium proteins?

Recent developments in M. genitalium serology provide valuable methodological insights:

An immunoblot assay based on a recombinant fragment of the M. genitalium MG075 protein present in lipid-associated membrane extracts has shown promising results in detecting specific antibody responses . This assay achieved:

  • 87.1% sensitivity when testing sera from 101 adults with PCR-confirmed M. genitalium infection

  • 95.2% specificity when evaluated using sera from 166 children under 15 years of age with and without M. pneumoniae infection

These approaches could be adapted for studying immune responses to other M. genitalium proteins, including uncharacterized ones like MG441.

How can researchers address cross-reactivity challenges when studying M. genitalium proteins?

Cross-reactivity, particularly with the closely related respiratory pathogen M. pneumoniae, presents a major challenge in developing specific detection methods for M. genitalium proteins . Researchers can address this challenge through:

  • Careful selection of protein regions with minimal sequence homology to related species

  • Use of recombinant protein fragments rather than whole proteins to improve specificity

  • Rigorous negative controls using sera from individuals with M. pneumoniae but not M. genitalium infection

  • Testing against pediatric populations who are unlikely to have been exposed to sexually transmitted M. genitalium

  • Complementary use of multiple detection methods to confirm specificity

How might characterization of MG441 contribute to understanding M. genitalium pathogenesis?

Characterizing uncharacterized proteins like MG441 could provide several insights into M. genitalium pathogenesis:

  • Identification of novel virulence factors that contribute to reproductive tract pathology

  • Discovery of unique surface proteins that may mediate host cell attachment or immune evasion

  • Elucidation of mechanisms underlying antibiotic resistance, which is increasingly concerning in M. genitalium infections

  • Understanding of essential metabolic pathways that might serve as therapeutic targets

The compact genome of M. genitalium suggests that many of its proteins serve essential functions, making uncharacterized proteins like MG441 potentially important for understanding the organism's basic biology and pathogenic mechanisms.

What functional genomics approaches would be most effective for determining the role of MG441?

To determine the function of uncharacterized proteins like MG441, researchers should consider a multi-faceted functional genomics approach:

  • Gene knockout or knockdown studies to observe phenotypic changes in growth, morphology, or virulence

  • Transcriptomic analysis to identify conditions under which the gene is expressed

  • Protein-protein interaction studies to identify binding partners and potential complexes

  • Localization studies to determine subcellular distribution (membrane, cytoplasmic, etc.)

  • Comparative genomics across Mycoplasma species to identify conserved domains suggesting functional importance

These approaches, combined with structural predictions, can provide complementary evidence for functional annotation.

How can structural information inform functional hypotheses for uncharacterized proteins?

Structural information can provide valuable insights into protein function through:

  • Identification of structural motifs associated with specific enzymatic activities or binding functions

  • Detection of surface features like pockets or grooves that might represent active sites

  • Recognition of protein folds associated with particular biological functions

  • Prediction of potential binding partners based on surface complementarity

For the four uncharacterized M. genitalium proteins mentioned in the research (MG129, MG219, MG353, and MG449), structural predictions enabled functional inferences even in the absence of clear sequence homology . Similar approaches could be applied to MG441.

What controls should be included when working with recombinant M. genitalium proteins?

Rigorous experimental design for studies involving recombinant M. genitalium proteins should include:

  • Expression controls:

    • Empty vector controls

    • Positive controls with well-characterized proteins expressed under identical conditions

    • Verification of protein identity through mass spectrometry

  • Serological controls:

    • Sera from PCR-confirmed M. genitalium-positive individuals

    • Sera from individuals with M. pneumoniae but not M. genitalium infection

    • Sera from individuals with no history of either infection

    • Pediatric sera as a control group unlikely to have sexually transmitted M. genitalium exposure

  • Specificity controls:

    • Testing against related Mycoplasma species proteins

    • Competition assays with native and recombinant proteins

How can researchers validate computational structure predictions experimentally?

Experimental validation of predicted protein structures should employ multiple complementary techniques:

  • X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy for high-resolution structure determination

  • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

  • Limited proteolysis to identify domain boundaries and flexible regions

  • Site-directed mutagenesis of predicted functional residues followed by activity assays

  • Cross-linking studies to validate predicted protein-protein interaction interfaces

These experimental approaches can confirm or refine computational predictions, particularly for previously uncharacterized proteins like MG441.

What methodological approaches can resolve discrepancies between computational predictions and experimental results?

When computational predictions and experimental results disagree, researchers should systematically investigate the source of discrepancies through:

  • Refinement of computational models using experimental constraints

  • Consideration of protein dynamics and conformational flexibility not captured in static models

  • Evaluation of experimental conditions that might influence protein structure (pH, ionic strength, ligand binding)

  • Assessment of potential post-translational modifications not accounted for in computational models

  • Iterative refinement combining computational and experimental approaches

For M. genitalium proteins, researchers have noted that computational prediction challenges often arise from proteins that form complexes, where isolated monomer structures might differ from their complex-bound conformations .

How might characterization of proteins like MG441 contribute to diagnostic development?

Understanding the structure and function of uncharacterized M. genitalium proteins has significant implications for diagnostic development:

  • Identification of highly specific biomarkers that distinguish M. genitalium from related pathogens

  • Development of serological assays capable of accurately detecting past M. genitalium infection, which is critical for epidemiological studies

  • Creation of multiplex detection platforms targeting several M. genitalium proteins simultaneously

  • Improvement of PCR-based detection through identification of conserved sequences unique to M. genitalium

The recent development of an immunoblot assay based on the MG075 protein demonstrates how characterization of specific M. genitalium proteins can lead to improved diagnostic capabilities .

What are the implications of M. genitalium protein characterization for therapeutic development?

Characterization of uncharacterized proteins in the minimal genome of M. genitalium has several implications for therapeutic development:

  • Identification of essential proteins that could serve as novel drug targets

  • Understanding of mechanisms underlying antimicrobial resistance

  • Discovery of potential vaccine candidates that could prevent infection

  • Elucidation of host-pathogen interactions that could be disrupted therapeutically

The increasing prevalence of antibiotic-resistant M. genitalium strains makes the identification of novel therapeutic targets particularly important for public health.

How does protein characterization in M. genitalium inform our understanding of minimal genomes and synthetic biology?

As an organism with one of the smallest known genomes, M. genitalium serves as a model for understanding the minimal set of genes necessary for cellular life. Characterization of its proteins, including uncharacterized ones like MG441, contributes to:

  • Defining the core functions necessary for cellular survival and reproduction

  • Informing synthetic biology efforts to create minimal artificial cells

  • Understanding the evolution of bacterial genomes through reduction

  • Identifying essential biological processes that may be broadly conserved across life forms

The computational and experimental approaches described for studying M. genitalium proteins provide valuable methodologies for characterizing proteins in other minimal or synthetic genomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.