Recombinant Mycoplasma genitalium Uncharacterized protein MG443 (MG443)

Shipped with Ice Packs
In Stock

Description

Table 1: Biophysical Properties of Recombinant MG443

PropertyDetails
UniProt IDP47681
Species OriginMycoplasma genitalium (strain ATCC 33530/G-37)
Expression SystemE. coli
TagN-terminal His-tag
Purity>85–90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Production and Purification

Recombinant MG443 is generated through the following workflow:

  1. Gene Cloning: Full-length MG443 (1–395 aa) is cloned into an E. coli expression vector .

  2. Expression: Induced under optimized conditions, yielding inclusion bodies due to hydrophobicity .

  3. Purification: Affinity chromatography using nickel-NTA resins followed by refolding .

  4. Quality Control: Validated via SDS-PAGE and Western blot with anti-His antibodies .

Challenges:

  • Solubility: Requires denaturing agents (e.g., 6–8 M urea) for handling .

  • Storage: Repeated freeze-thaw cycles degrade stability; glycerol (5–50%) is recommended for aliquots .

Research Applications

Though functionally uncharacterized, recombinant MG443 has been utilized in:

  • Antigenic Studies: Screened for immunogenicity in serological assays, though cross-reactivity with M. pneumoniae limits diagnostic use .

  • Structural Biology: Hydrophobicity profiling informs membrane protein modeling .

  • Comparative Genomics: MG443’s conservation across M. genitalium strains suggests a potential role in pathogenicity .

Functional Hypotheses

While direct functional data are lacking, contextual insights from related proteins suggest:

  • Adhesion: Homology to M. genitalium adhesins (e.g., MgPa) implies a role in host-cell binding .

  • Immune Evasion: Sequence variability in MGPar loci may enable antigenic variation .

  • Metabolic Role: Potential interaction with ribosomal proteins (e.g., RPL35) to modulate host-cell proliferation .

Limitations and Future Directions

  • Uncharacterized Function: No knockout studies or binding partners identified .

  • Diagnostic Potential: Cross-reactivity with M. pneumoniae complicates serological use .

  • Engineering Needs: Solubility optimization required for advanced structural studies .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point for your convenience.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of your preferred tag.
Synonyms
MG443; Uncharacterized protein MG443
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG443
Target Protein Sequence
MKFFNNLFKKESKITVASGSKRVRISNSFLMFSNLYEAKKPLKYVLVYLLSIINAFLLLI FIQKTGLYSFGISSLTQGFARLVFVLLKSFDETQRLLIFNILYWLLYVFINIPLIIFSYK KIGKNFTILSTHFVVASNVFGFLISIIPGSDNLPPMLASITDTNFWKAAKDLNQSAGFVP FLWSDTSQGNVIISTFIYAAIYGFYNGISVSLLYILGGSAGGADFLTQYYARKKNRSVGS ILFYVNSFILIIAILIGSFVAGSLLLQDVNNYRDSAWEVSLFFSPNLIATFFSILLTGTV VSYLFPRYNFAEIKVFTDKLEEVRKALLSDNANHSLSIQETLGGYSLLKKKMIVSVSMYV EIPHLIKIIRQIDKDCLVSITRIRGIDGHIYLRQN
Uniprot No.

Target Background

Database Links

KEGG: mge:MG_443

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Mycoplasma genitalium Uncharacterized protein MG443?

Recombinant Mycoplasma genitalium Uncharacterized protein MG443 (MG443) is a full-length protein (395 amino acids) derived from the bacterial species Mycoplasma genitalium. This protein is classified as "uncharacterized," indicating that its specific biological function has not been fully elucidated in current scientific literature. The recombinant version is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. According to protein databases, it is identified by the UniProt ID P47681 and contains a specific amino acid sequence beginning with "MKFFNNLFKKESKITVASGSKR" and continuing through a 395-amino acid sequence .

The protein's full sequence includes multiple hydrophobic regions that suggest potential membrane-spanning domains, which is consistent with many Mycoplasma proteins that interact with host cell membranes. When working with this protein, researchers should note that its uncharacterized status presents both challenges and opportunities for novel discoveries regarding its structure-function relationships and potential role in Mycoplasma genitalium pathogenicity.

How does MG443 compare to its homologs in other Mycoplasma species?

MG443 has identified homologs in other Mycoplasma species, notably the MPN_657 protein in Mycoplasma pneumoniae . Sequence alignment analysis reveals conserved domains between these proteins, suggesting potential evolutionary conservation of function across Mycoplasma species. The existence of these homologs provides researchers with comparative frameworks for studying functional conservation and divergence.

When designing experiments involving MG443, researchers should consider parallel studies with homologs like MPN_657 to establish functional correlations. This comparative approach can be particularly valuable when investigating protein-protein interactions, subcellular localization patterns, or phenotypic effects following gene knockout or overexpression. The identification of functional domains that are conserved across multiple Mycoplasma species may indicate regions of particular biological significance worth targeting in mutational studies.

What are the optimal storage and handling conditions for recombinant MG443?

Recombinant MG443 protein requires specific storage and handling conditions to maintain structural integrity and functional activity. The lyophilized powder form should be stored at -20°C/-80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein stability . For reconstitution, deionized sterile water should be used to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) recommended for long-term storage .

Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein denaturation and aggregation. The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability . Prior to opening vials, brief centrifugation is recommended to bring the contents to the bottom. Researchers should maintain sterile technique when handling the protein to prevent microbial contamination that could affect experimental outcomes and protein stability.

What experimental techniques are most suitable for studying the structure and function of MG443?

Several experimental approaches can be employed to elucidate the structure and function of MG443. For structural analysis, a combination of X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, and cryo-electron microscopy can provide insights into the three-dimensional conformation. Given the protein's size (395 amino acids), cryo-EM may be particularly suitable for visualizing its native structure. For functional characterization, protein-protein interaction studies using techniques such as yeast two-hybrid assays, co-immunoprecipitation, or proximity labeling approaches can help identify binding partners.

Considering the hydrophobic regions in the amino acid sequence, membrane association studies using fractionation techniques followed by Western blotting would be valuable to determine subcellular localization. Additionally, recombinant expression of truncated variants can help identify functional domains. For in vitro functional studies, purified MG443 can be tested in enzymatic assays to screen for potential catalytic activities. Since the protein's function remains uncharacterized, a systematic approach combining multiple techniques will likely be necessary to establish its biological role in Mycoplasma genitalium.

How can researchers effectively reconstitute and verify the activity of recombinant MG443?

Effective reconstitution of recombinant MG443 requires careful attention to buffer conditions and protein concentration. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being standard practice for many laboratories . Following reconstitution, verification of protein integrity can be performed using SDS-PAGE, which should show a band corresponding to the expected molecular weight of approximately 43-45 kDa (accounting for the His-tag).

Activity verification poses a challenge due to the uncharacterized nature of MG443. Researchers might consider developing binding assays with potential interaction partners predicted through bioinformatic analysis of the protein sequence. Additionally, circular dichroism spectroscopy can confirm proper protein folding by analyzing secondary structure elements. If antibodies against MG443 are available, immunological detection methods can verify the presence and integrity of epitopes. For recombinant proteins with His-tags, a nickel-NTA binding assay can confirm the accessibility and functionality of the tag, which is particularly important if further purification steps are planned.

What are the known applications of SDS-PAGE for analyzing MG443?

SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis) serves as a primary analytical technique for MG443 characterization . This method allows researchers to verify protein purity, molecular weight, and integrity after expression and purification. When analyzing MG443, researchers typically observe a band at approximately 43-45 kDa, which corresponds to the full-length protein (395 amino acids) plus the N-terminal His-tag.

For more detailed analysis, researchers can employ various staining methods post-SDS-PAGE. Coomassie Blue staining provides general protein visualization with a detection limit of approximately 100 ng per band. For higher sensitivity, silver staining can detect as little as 1-10 ng of protein. Western blotting using anti-His antibodies offers a specific detection method for confirming the presence of the His-tagged MG443 and can be particularly useful when analyzing complex samples or when checking for potential degradation products. Additionally, two-dimensional gel electrophoresis combining isoelectric focusing with SDS-PAGE can reveal potential post-translational modifications or isoforms of MG443 that might have functional significance in experimental systems.

How can researchers address contradictory findings when studying MG443 function?

When confronting contradictory findings regarding MG443 function, researchers should implement a systematic analytical approach. First, methodological differences between studies should be carefully examined, as variations in expression systems, purification methods, or experimental conditions can significantly impact protein behavior. For instance, the presence of the His-tag may influence protein folding or interaction properties in some experimental contexts but not others. Cross-validation using multiple experimental techniques becomes essential for resolving contradictions.

What bioinformatic approaches can predict potential functions of MG443?

Multiple bioinformatic approaches can provide insights into the potential functions of MG443. Sequence homology searches using tools like BLAST can identify similar proteins with known functions across different organisms. For MG443, the identification of the homolog MPN_657 in Mycoplasma pneumoniae provides a comparative reference point . Protein domain prediction tools such as SMART, Pfam, or InterProScan can identify conserved functional domains that might suggest enzymatic activities or binding capabilities.

Structural prediction methods, including AlphaFold or I-TASSER, can generate three-dimensional models of MG443 based on its amino acid sequence, potentially revealing structural similarities to proteins with known functions. The amino acid sequence of MG443 suggests multiple hydrophobic regions that may indicate membrane association, which can be further analyzed using transmembrane prediction algorithms like TMHMM or Phobius. Protein-protein interaction prediction tools such as STRING can suggest potential binding partners based on co-expression data, genomic context, and experimental evidence from related proteins. Additionally, gene neighborhood analysis in the Mycoplasma genitalium genome can provide contextual information about potential functional pathways involving MG443. Combining these computational approaches creates a multi-layered prediction framework that can guide experimental validation efforts.

What experimental designs are most effective for investigating protein-protein interactions involving MG443?

Investigating protein-protein interactions involving MG443 requires a multi-faceted experimental approach. Pull-down assays using the His-tagged recombinant MG443 as bait can capture potential binding partners from Mycoplasma genitalium lysates or from relevant host cell extracts if host-pathogen interactions are suspected. These interactions can be subsequently identified using mass spectrometry-based proteomics. Co-immunoprecipitation provides an alternative approach when specific antibodies against MG443 are available, allowing for the capture of protein complexes under native conditions.

For detecting direct interactions and determining binding affinities, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative measurements. Yeast two-hybrid screening offers a genetic approach for detecting binary interactions, though membrane-associated proteins like MG443 may require modified systems such as membrane yeast two-hybrid. Proximity-based labeling methods, including BioID or APEX, involve tagging MG443 with an enzyme that labels nearby proteins, allowing for the identification of the protein's interaction neighborhood in living cells. Cross-linking mass spectrometry can capture transient interactions by covalently linking proteins in close proximity before analysis. Finally, fluorescence techniques such as Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize interactions in real-time within living cells, providing spatial and temporal information about MG443 interactions.

How should researchers interpret SDS-PAGE results for MG443?

Interpreting SDS-PAGE results for MG443 requires attention to several key parameters. The expected molecular weight for the full-length protein (395 amino acids) with an N-terminal His-tag is approximately 43-45 kDa . When analyzing gel results, researchers should look for a prominent band at this position to confirm successful expression and purification. The purity of the preparation can be assessed by examining the presence of additional bands, with high-quality preparations typically showing greater than 90% purity .

Multiple bands may indicate proteolytic degradation, incomplete translation, or the presence of contaminants. If degradation is suspected, optimizing purification conditions or adding protease inhibitors during extraction may be necessary. For quantitative analysis, densitometry can be performed by comparing band intensity to known protein standards. When transferring to Western blot analysis, efficient transfer of proteins in this size range typically requires 60-90 minutes at 100V using standard transfer buffers. If the protein appears to run at an unexpected molecular weight, this could indicate post-translational modifications, incomplete denaturation, or anomalous migration due to the protein's amino acid composition. Comparing results across different percentage acrylamide gels can help resolve such discrepancies.

What statistical approaches are recommended for analyzing experimental data related to MG443?

Statistical analysis of MG443 experimental data should align with the specific experimental design while adhering to rigorous standards. For quantitative assays measuring protein expression, activity, or interaction strength, descriptive statistics including means, standard deviations, and confidence intervals provide a foundation for data interpretation. When comparing experimental conditions, inferential statistics such as t-tests for two-group comparisons or ANOVA for multiple groups are appropriate, with post-hoc tests (e.g., Tukey's HSD) to identify specific differences when ANOVA indicates significance.

For dose-response experiments or binding kinetics studies, non-linear regression models can determine parameters such as EC50, IC50, or Kd values. Statistical power analysis should be conducted before experiments to determine appropriate sample sizes, particularly when working with variable biological systems. When dealing with contradictory findings across experiments, meta-analytical approaches can integrate results from multiple studies to identify consistent patterns . For complex datasets, multivariate statistical methods such as principal component analysis or cluster analysis may reveal patterns not apparent in univariate analyses. Regardless of the specific methods employed, transparency in reporting statistical approaches, including p-values, effect sizes, and confidence intervals, is essential for reproducibility and interpretation by the scientific community.

How can researchers distinguish between genuine findings and artifacts when studying an uncharacterized protein like MG443?

Distinguishing genuine findings from artifacts when studying uncharacterized proteins like MG443 requires methodological rigor and multiple validation approaches. First, researchers should implement appropriate controls at each experimental stage. For recombinant protein studies, this includes empty vector controls, tag-only controls, and unrelated protein controls with similar properties. Concentration-dependent effects should be established by testing multiple protein concentrations, as artifacts often do not show dose-response relationships.

Cross-validation using orthogonal experimental techniques provides stronger evidence than findings from a single approach. For instance, protein-protein interactions detected by pull-down assays should be confirmed using techniques like co-immunoprecipitation or FRET. When analyzing contradictory data, researchers should systematically evaluate potential sources of variance including experimental conditions, reagent quality, and methodological differences . Reproducibility testing across different laboratories or by different researchers within the same laboratory strengthens confidence in genuine findings.

For novel or unexpected results, researchers should consider evolutionary conservation - effects observed with both MG443 and its homologs (like MPN_657) are more likely to represent genuine biological phenomena . Finally, correlation with phenotypic outcomes provides functional validation; for example, demonstrating that MG443 knockout or overexpression produces predictable changes in Mycoplasma genitalium behavior or host cell interactions would support functional hypotheses.

What is the potential significance of MG443 in understanding Mycoplasma genitalium pathogenicity?

MG443's potential significance in Mycoplasma genitalium pathogenicity stems from several key considerations. The protein's amino acid sequence suggests multiple hydrophobic regions that may indicate membrane association , positioning it as a potential mediator of host-pathogen interactions. Membrane proteins often play crucial roles in bacterial adhesion, invasion, and immune evasion. The conservation of MG443 homologs across different Mycoplasma species, including the MPN_657 protein in M. pneumoniae , suggests potential functional importance in the broader context of Mycoplasma pathogenesis.

As an uncharacterized protein, MG443 represents an unexplored aspect of M. genitalium biology that may reveal novel virulence mechanisms. The bacterium's minimal genome (approximately 580 kb) means that retained proteins likely serve essential functions. Understanding MG443's role could provide insights into M. genitalium's remarkable success as a pathogen despite its limited genetic repertoire. Given the increasing antibiotic resistance observed in M. genitalium clinical isolates, proteins like MG443 may represent novel therapeutic targets. If functional studies establish its importance in bacterial survival or virulence, it could become a candidate for targeted antimicrobial development. Additionally, recombinant MG443 could potentially serve as a biomarker for diagnostic applications or as a component in vaccine development strategies aiming to prevent M. genitalium infections.

How might researchers develop effective experimental models to study MG443 in a physiological context?

Developing experimental models to study MG443 in physiological contexts requires thoughtful design that balances simplicity with biological relevance. Cell culture models using relevant host cells (e.g., human urogenital epithelial cells for M. genitalium) provide a controlled environment for studying MG443's role in host-pathogen interactions. These systems can be enhanced by generating fluorescently tagged MG443 constructs for live-cell imaging of protein localization and dynamics during infection. For functional studies, gene knockout or knockdown approaches in M. genitalium using CRISPR-Cas systems or antisense RNA can reveal phenotypic consequences of MG443 depletion.

Complementary to genetic approaches, researchers can develop heterologous expression systems where MG443 is expressed in a non-pathogenic bacterial host to assess its specific contribution to adhesion, invasion, or other virulence-associated phenotypes. Three-dimensional tissue culture models, such as organoids derived from relevant human tissues, provide more physiologically accurate environments than traditional monolayer cultures. For in vivo relevance, animal models of M. genitalium infection, though challenging to establish, offer the most comprehensive physiological context. Additionally, reconstructed in vitro systems combining purified components (e.g., MG443, host cell membranes, and other relevant factors) allow for controlled mechanistic studies of direct molecular interactions. Each model system has distinct advantages and limitations, making a multi-model approach optimal for comprehensive characterization of MG443's physiological roles.

What are the most promising future research directions for understanding MG443 function?

Future research on MG443 should pursue several promising directions to comprehensively characterize this uncharacterized protein. Structure-function analysis represents a foundational approach, with high-resolution structural determination using X-ray crystallography or cryo-electron microscopy providing insights into potential functional domains. This structural information can guide targeted mutagenesis studies to identify critical residues for function. Interactome mapping using techniques such as proximity labeling combined with mass spectrometry can reveal MG443's protein-protein interaction network within M. genitalium and during host-pathogen interactions.

Comparative genomics and evolutionary analysis comparing MG443 with homologs like MPN_657 in M. pneumoniae can identify conserved features that suggest functional importance. Integration of multi-omics data, including transcriptomics, proteomics, and metabolomics from MG443 mutant strains, can provide a systems-level understanding of the protein's role in bacterial physiology. Host response studies examining how MG443 influences host cell signaling, cytokine production, or cytoskeletal rearrangements may reveal its role in pathogenesis. Development of specific antibodies or small molecule inhibitors targeting MG443 could validate its importance through functional neutralization while potentially offering therapeutic applications. Finally, clinical correlation studies examining MG443 sequence variations or expression levels across clinical isolates with different virulence profiles could establish links between this protein and disease outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.