Recombinant Mycoplasma genitalium Uncharacterized protein MG456 (MG456)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional charges apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MG456; Uncharacterized protein MG456
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
Target Names
MG456
Target Protein Sequence
MSDLTKFNKFFLTPNKLNAFLRVIGLCGLFSVIAISFGIYSYTRNEIPNIASLFLIVLGS VVLFLAFVIHFAALFKRNKLLKKVNKENRTNLWQKEMGNFKAIESFEFFEQGPISSDILP SFYPTALYNFEPLPRQFKVTYKDGSEFVFGHIYAIKRSSNKTEKVACLIAITPAINSENH FFLTDANYSLNKNVAQFEALTENKKQENISLFVEKDSNFSFQNLDTEVLNKVLFNPLNVY AKFNVYNDTVHTYLFMSVPTTFMDTKLKVNEAFDDLVTNIKLQASYDFKTLNSMQKVVDL LHNKLIKKPESKSSSQKSVETEIEKEVKDKLAKN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MG456 and what organism does it originate from?

MG456 is an uncharacterized protein from the bacterial species Mycoplasma genitalium, a sexually transmitted pathogen associated with various urogenital infections. The protein consists of 334 amino acids and is available as a recombinant protein expressed in E. coli with a histidine tag to facilitate purification and detection in laboratory settings. Although classified as "uncharacterized," ongoing research aims to elucidate its structure and function within the bacterial proteome. M. genitalium has one of the smallest genomes among self-replicating organisms, making each of its proteins, including MG456, potentially significant for its survival and pathogenicity .

How is recombinant MG456 protein typically produced for research purposes?

Recombinant MG456 protein is typically produced using E. coli expression systems. The gene encoding MG456 is cloned into an appropriate expression vector containing a histidine tag sequence, transformed into E. coli, and expression is induced under controlled conditions. The full-length protein (amino acids 1-334) is then purified using affinity chromatography techniques that leverage the His-tag. This approach enables researchers to obtain sufficient quantities of the protein for structural studies, functional assays, and other research applications .

For optimal expression, researchers should consider:

  • Selection of an appropriate E. coli strain compatible with Mycoplasma genitalium codon usage

  • Optimization of induction conditions (temperature, inducer concentration, duration)

  • Implementation of gentle lysis methods to preserve protein structure

  • Purification under conditions that maintain protein stability and solubility

  • Verification of protein integrity using SDS-PAGE and Western blotting

What experimental techniques are recommended for detecting MG456 in clinical or laboratory samples?

For detecting MG456 in research samples, a multi-faceted approach is recommended:

  • Antibody-based detection: Using MG456-specific antibodies for Western blotting, ELISA, or immunofluorescence microscopy. When working with His-tagged recombinant protein, anti-His antibodies can also be employed.

  • Mass spectrometry: Liquid chromatography-mass spectrometry (LC-MS/MS) for protein identification and potential post-translational modification analysis.

  • PCR-based detection: For clinical samples, nucleic acid amplification tests targeting the MG456 gene, similar to approaches used for detecting Mycoplasma genitalium in clinical specimens.

  • Radiolabeling approaches: Methods similar to those used with MG456 cell lines in cancer research can be adapted, where high uptake of radioactive tracers like 125I IQ has been demonstrated in specific cell populations .

For clinical samples specifically, researchers should be aware that Mycoplasma genitalium has a prevalence ranging from 10.0% to 22.1% depending on the population studied, requiring sensitive detection methods .

How can researchers design experiments to investigate the potential function of MG456?

To systematically investigate the function of the uncharacterized MG456 protein, researchers should implement a multi-disciplinary approach:

  • Computational predictions:

    • Conduct sequence homology analyses comparing MG456 to characterized proteins

    • Perform protein structure prediction using AlphaFold2 or similar tools

    • Use domain prediction algorithms to identify functional motifs

    • Apply protein-protein interaction prediction methods to hypothesize binding partners

  • Gene knockout/knockdown studies:

    • Generate MG456 deletion mutants in M. genitalium

    • Assess phenotypic changes (growth rate, morphology, virulence)

    • Perform complementation studies to confirm observed phenotypes

  • Protein interaction studies:

    • Conduct pull-down assays using His-tagged recombinant MG456

    • Perform yeast two-hybrid screening

    • Use protein crosslinking followed by mass spectrometry

    • Implement co-immunoprecipitation with antibodies against MG456

  • Localization studies:

    • Use immunogold electron microscopy to determine subcellular localization

    • Generate fluorescently tagged versions for live-cell imaging

  • Statistical experimental design:

    • Implement full factorial designs at multiple levels to investigate different conditions

    • Apply confidence levels of 95% for statistical analyses, similar to approaches used in other recombinant protein research

Document all findings systematically, including negative results, to contribute to the knowledge base for this uncharacterized protein.

What are the recommended approaches for studying potential antimicrobial resistance mechanisms involving MG456?

Given the high prevalence of antimicrobial resistance in Mycoplasma genitalium globally, investigating MG456's potential role in resistance mechanisms requires specialized approaches:

  • Comparative expression analysis:

    • Compare MG456 expression levels between antimicrobial-resistant and susceptible strains

    • Perform RNA-seq or qPCR analysis before and after antibiotic exposure

    • Correlate expression changes with specific resistance phenotypes

  • Protein-antibiotic interaction studies:

    • Conduct binding assays between purified MG456 and various antibiotics

    • Perform thermal shift assays to detect potential interactions

    • Use surface plasmon resonance to quantify binding affinities

  • Genetic modification approaches:

    • Overexpress MG456 in susceptible strains and assess changes in minimum inhibitory concentrations

    • Introduce MG456 into heterologous hosts to assess potential resistance transfer

    • Generate point mutations in MG456 based on sequence variations observed in resistant clinical isolates

  • Structural biology approaches:

    • Determine MG456 crystal structure to identify potential antibiotic binding sites

    • Compare structures in the presence and absence of antibiotics

Remember to include controls that analyze established resistance mechanisms in M. genitalium, particularly those involving mutations in the 23S rRNA gene and parC gene, which are already associated with antimicrobial resistance in this pathogen .

What cell culture systems are most appropriate for studying MG456 function in vitro?

When selecting cell culture systems for studying MG456 function, researchers should consider both prokaryotic and eukaryotic systems:

Prokaryotic Systems:

  • M. genitalium axenic cultures (challenging but most physiologically relevant)

  • E. coli expression systems for protein production and bacterial two-hybrid studies

  • Other mycoplasma species for comparative studies

Eukaryotic Systems:

  • Human urogenital epithelial cell lines (for host-pathogen interaction studies)

  • MG456 glioblastoma cell lines, which have shown utility in radiotracer uptake studies

  • CD133+ and CD133- sorted cell fractions for studying differential protein behavior

Co-culture Systems:

  • M. genitalium with human immune cells to study inflammatory responses

  • Mixed microbial communities to assess interspecies interactions

Optimization Parameters for Cell Culture:

  • Media composition (consider supplementation with KNO₃ at 2-35 g/L range)

  • Growth factors (NAA at 1-20 mg/L range)

  • Signaling molecules (methyl jasmonate at 9-250 μM range)

  • Temperature and pH conditions

  • Oxygen tension

When working with MG456 cell lines, implement magnetic column separation techniques for isolating specific cell populations as demonstrated in previous research protocols .

How can researchers investigate potential post-translational modifications of MG456?

Investigating post-translational modifications (PTMs) of MG456 requires sophisticated analytical approaches:

  • Mass Spectrometry-Based Approaches:

    • Perform high-resolution LC-MS/MS analysis of purified MG456

    • Use enrichment strategies for specific PTMs (phosphorylation, glycosylation)

    • Implement multiple fragmentation methods (CID, ETD, HCD) for comprehensive coverage

    • Apply targeted and untargeted proteomics workflows

  • Site-Directed Mutagenesis:

    • Systematically mutate predicted modification sites

    • Assess functional consequences of mutations using activity assays

    • Compare wild-type and mutant protein behaviors in cellular contexts

  • PTM-Specific Detection Methods:

    • Western blotting with modification-specific antibodies

    • Specialized staining techniques (Pro-Q Diamond for phosphorylation, PAS staining for glycosylation)

    • Mobility shift assays to detect modifications affecting protein migration

  • Temporal Dynamics:

    • Study modification patterns under different growth conditions

    • Assess changes during infection progression

    • Monitor modifications in response to antimicrobial exposure

Create a comprehensive map of all detected modifications with their specific locations within the 334-amino acid sequence of MG456, and correlate these with potential functional domains within the protein structure .

What are the best approaches for analyzing potential structural changes in MG456 under different physiological conditions?

To analyze structural changes in MG456 under varying physiological conditions, researchers should employ multiple complementary structural biology techniques:

Consider implementing similar experimental design principles as used in other recombinant protein studies, including full factorial designs at three levels with carefully selected variables .

How can researchers design studies to investigate MG456's potential role in M. genitalium pathogenesis?

To investigate MG456's potential role in M. genitalium pathogenesis, researchers should implement a systematic approach combining molecular, cellular, and clinical methodologies:

  • Expression Analysis in Clinical Isolates:

    • Compare MG456 expression levels between isolates from symptomatic and asymptomatic cases

    • Correlate expression with disease severity metrics

    • Analyze expression patterns in antimicrobial-resistant strains, particularly those with mutations in 23S rRNA and parC genes

  • Adhesion and Invasion Assays:

    • Generate MG456 knockout strains and assess their ability to adhere to host cells

    • Use fluorescently labeled bacteria to quantify internalization rates

    • Implement live-cell imaging to track infection dynamics in real-time

  • Host Response Studies:

    • Measure cytokine/chemokine production by host cells exposed to wild-type vs. MG456-deficient M. genitalium

    • Assess activation of pattern recognition receptors and signaling pathways

    • Evaluate differences in host cell transcriptome via RNA-seq analysis

  • Animal Model Studies:

    • Develop appropriate animal models for M. genitalium infection

    • Compare colonization, persistence, and tissue damage between wild-type and MG456-deficient strains

    • Evaluate immune responses in vivo

  • Biofilm Formation Analysis:

    • Assess the contribution of MG456 to biofilm development

    • Evaluate antibiotic susceptibility in biofilm contexts

    • Study mixed-species biofilms when relevant

  • Co-infection Models:

    • Investigate interactions with other STI pathogens commonly found as co-infections

    • Study potential synergistic effects with Chlamydia trachomatis, Neisseria gonorrhoeae, and Trichomonas vaginalis

    • Assess MG456's role in polymicrobial infection scenarios

  • Immune Evasion Mechanisms:

    • Investigate potential immune suppression or modulation functions

    • Study interaction with complement components and antimicrobial peptides

    • Assess effects on phagocytosis and antigen presentation

Document findings carefully, including prevalence data from different populations and geographical regions to contextualize results within global M. genitalium epidemiology .

How should researchers address contradictory findings in MG456 functional studies?

When confronted with contradictory findings in MG456 research, implement the following systematic approach:

  • Methodological Comparison and Standardization:

    • Create a comprehensive table comparing experimental conditions across contradictory studies

    • Standardize key protocols to enable direct comparison of results

    • Implement round-robin testing across multiple laboratories

    • Consider developing a consensus MG456 reference material

  • Statistical Reanalysis:

    • Conduct meta-analysis of available data when sample sizes permit

    • Apply statistical approaches used in experimental design for recombinant proteins, such as full factorial design at three levels with 95% confidence intervals

    • Implement Bayesian analysis to incorporate prior knowledge

    • Perform sensitivity analyses to identify influential variables

  • Contradiction Detection Framework:

    • Adopt systematic contradiction detection approaches similar to those used in conversational analysis and natural language processing

    • Categorize contradictions as methodological, interpretative, or fundamental

    • Map contradictions to specific domains (structural, functional, clinical)

  • Independent Validation Studies:

    • Design experiments specifically targeting the contradictory findings

    • Include positive and negative controls for each experimental condition

    • Implement blinded analysis of results

    • Publish validation studies regardless of outcome

  • Research Community Engagement:

    • Organize focused workshops on MG456 contradictions

    • Establish collaborative networks to address specific discrepancies

    • Develop shared databases for raw experimental data

Remember that contradictions often highlight important biological nuances rather than experimental failures and may lead to discovery of condition-specific protein behaviors.

What statistical approaches are most appropriate for analyzing MG456 experimental data?

For analyzing MG456 experimental data, researchers should implement rigorous statistical methodologies tailored to the specific experimental design:

  • Experimental Design Considerations:

    • Implement full factorial designs at three levels when studying multiple variables

    • Use a confidence level of 95% for statistical experimental designs

    • Consider specialized software like Modde v12.0 for design optimization

    • Assess normality of data with Shapiro-Wilk's test before selecting parametric or non-parametric analyses

  • Comparative Analyses:

    • For comparing MG456 expression levels across conditions:

      • ANOVA with appropriate post-hoc tests for multiple group comparisons

      • t-tests (paired or unpaired) for two-group comparisons

      • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when normality assumptions are violated

  • Correlation and Regression Analyses:

    • Pearson or Spearman correlation for assessing relationships between MG456 expression and other variables

    • Multiple regression to identify predictors of MG456 function

    • Logistic regression for binary outcomes (e.g., pathogenicity, resistance)

  • Time Series Analyses:

    • Repeated measures ANOVA for longitudinal studies

    • Mixed-effect models for nested data structures

    • Time series analysis for temporal expression patterns

  • High-Dimensional Data Analysis:

    • Principal component analysis (PCA) for dimensionality reduction

    • Cluster analysis for identifying patterns in complex datasets

    • Machine learning approaches for predictive modeling

  • Sample Size and Power Calculations:

    • A priori power analysis to determine required sample sizes

    • Post-hoc power analysis to interpret negative results

    • Consideration of biological replicates (different biological samples) vs. technical replicates (repeated measurements)

  • Specialized Analyses for Specific Techniques:

    • For structural studies: statistical approaches for comparing protein conformations

    • For interaction studies: appropriate statistics for binding affinity measurements

    • For genomic/transcriptomic studies: multiple testing correction methods

When reporting results, provide comprehensive statistical details, including test selection rationale, exact p-values, effect sizes, and confidence intervals.

How can researchers integrate findings from different experimental platforms to build a comprehensive model of MG456 function?

Integrating diverse experimental data to build a comprehensive model of MG456 function requires a sophisticated multi-omics approach:

  • Data Integration Framework:

    • Implement a structured data integration pipeline with clearly defined workflows

    • Standardize data formats across platforms for compatibility

    • Establish quality control metrics for each data type

    • Create a centralized database for all MG456-related experimental results

  • Multi-omics Integration Strategies:

    • Implement vertical integration (connecting different data types for the same samples)

    • Apply horizontal integration (comparing similar data types across different conditions)

    • Utilize both unsupervised and supervised integration methods

    • Consider Bayesian network approaches for causal modeling

  • Computational Tools and Resources:

    • Network analysis tools to map MG456 interaction networks

    • Pathway enrichment algorithms to place MG456 in biological context

    • Machine learning approaches for pattern recognition across datasets

    • Visualization tools for multi-dimensional data representation

  • Integration Process:

    Data TypeIntegration ApproachTools/Methods
    GenomicVariant annotation, comparative genomicsBLAST, Clustal Omega, MEGA
    TranscriptomicCo-expression network analysisWGCNA, DESeq2, EdgeR
    ProteomicProtein-protein interaction networksSTRING, BioGRID, IntAct
    StructuralStructure-function relationship analysisPyMOL, UCSF Chimera, VMD
    PhenotypicCorrelation with molecular dataVarious statistical packages
    ClinicalAssociation studies with molecular markersR, Python, SPSS
  • Model Development and Validation:

    • Create initial hypothetical models of MG456 function

    • Test models against experimental data not used in model development

    • Refine models iteratively as new data becomes available

    • Implement sensitivity analysis to identify robust model components

  • Cross-validation Strategies:

    • Split available data into training and validation sets

    • Implement k-fold cross-validation where appropriate

    • Use biological replicates for independent validation

    • Challenge models with data from different experimental conditions

  • Model Documentation and Dissemination:

    • Create comprehensive documentation of model assumptions

    • Provide confidence metrics for different aspects of the model

    • Make models accessible through public repositories

    • Update models as new experimental evidence emerges

This integrated approach allows researchers to leverage the strengths of different experimental platforms while minimizing the limitations of any single method, ultimately leading to a more comprehensive understanding of MG456 function.

What are the most promising research directions for understanding MG456's role in M. genitalium biology?

Based on current knowledge of M. genitalium and uncharacterized proteins like MG456, several research directions show particular promise:

  • Systems Biology Approaches:

    • Integrating MG456 into whole-cell models of M. genitalium

    • Network analysis to identify functional relationships with characterized proteins

    • Flux-balance analysis to predict metabolic impacts of MG456 perturbation

    • Synthetic biology approaches to assess minimal gene set requirements

  • Evolutionary Perspectives:

    • Comparative genomics across Mycoplasma species to identify conserved features

    • Analysis of selection pressure on the MG456 gene

    • Investigation of horizontal gene transfer events involving MG456

    • Reconstruction of the evolutionary history of this protein family

  • Host-Pathogen Interface:

    • Role in adhesion, invasion, or immune evasion

    • Potential moonlighting functions within host cells

    • Contribution to persistent infection and antibiotic resistance

    • Investigation of MG456's potential as a biomarker for disease progression

  • Structural Genomics:

    • High-resolution structure determination

    • Identification of functional domains and active sites

    • Structure-based virtual screening for inhibitor discovery

    • Molecular dynamics studies to understand conformational flexibility

  • Antimicrobial Resistance Mechanisms:

    • Given the high prevalence of antimicrobial resistance in M. genitalium (with resistance-associated mutations in 23S rRNA and parC genes) , investigating MG456's potential contribution to resistance mechanisms

    • Development of MG456-targeted therapeutics if functional significance is established

Researchers should consider integrating these approaches rather than pursuing them in isolation to develop a comprehensive understanding of MG456's biological significance.

How can large-scale -omics approaches be applied to better characterize MG456 and its interactions?

Large-scale -omics approaches offer powerful tools for comprehensive characterization of MG456:

  • Genomics Applications:

    • Comparative genomics across clinical isolates to identify MG456 variants

    • Whole genome sequencing of resistant strains to correlate MG456 mutations with phenotypes

    • CRISPR-Cas9 screening to assess essentiality in different contexts

    • Saturation mutagenesis to map functionally important residues

  • Transcriptomics Approaches:

    • RNA-seq analysis to identify co-regulated genes across conditions

    • Single-cell RNA-seq to capture heterogeneity in expression

    • Ribosome profiling to assess translation efficiency

    • RNA structure probing to identify regulatory elements

  • Proteomics Strategies:

    • Comprehensive interactome mapping using proximity labeling methods

    • Quantitative proteomics to measure abundance changes across conditions

    • Phosphoproteomics and other PTM-focused approaches

    • Thermal proteome profiling to identify binding partners

    • CETSA (Cellular Thermal Shift Assay) for target engagement studies

  • Metabolomics Integration:

    • Metabolic profiling of wild-type vs. MG456-modified strains

    • Flux analysis using isotope-labeled precursors

    • Metabolite-protein interaction screening

  • Multi-omics Data Integration:

    Omics ApproachKey TechnologiesPrimary Applications for MG456
    GenomicsWGS, CRISPR screeningVariant identification, essentiality assessment
    TranscriptomicsRNA-seq, ribosome profilingCo-expression networks, regulation analysis
    ProteomicsMS/MS, BioID, APEXInteraction mapping, PTM identification
    MetabolomicsLC-MS, NMRMetabolic impact assessment
    Structural omicsCryo-EM, X-ray, NMRStructure-function relationships
  • Data Analysis Frameworks:

    • Machine learning approaches for pattern recognition

    • Network analysis tools for system-level understanding

    • Pathway enrichment for functional contextualization

    • Integrative visualization tools for multi-omics data

  • Technology Considerations:

    • Sample preparation optimization for the challenging M. genitalium system

    • Miniaturization for limited sample amounts

    • Specialized approaches for membrane-associated proteins if applicable

    • Integration of spatial information when possible

These approaches should be implemented with careful experimental design, including proper controls and statistical considerations, to generate reliable and reproducible results that advance understanding of MG456 function .

What are the implications of MG456 research for understanding antimicrobial resistance in M. genitalium?

Research on MG456 may provide critical insights into antimicrobial resistance mechanisms in M. genitalium, an increasingly important clinical challenge:

  • Context of AMR in M. genitalium:

    • Current data shows high prevalence of antimicrobial resistance in M. genitalium globally

    • Established resistance mechanisms include mutations in the 23S rRNA gene (macrolide resistance) and parC gene (fluoroquinolone resistance)

    • Additional undiscovered mechanisms likely exist, potentially involving uncharacterized proteins like MG456

  • Potential Contributions of MG456 to Resistance:

    • If involved in cell envelope maintenance: altered permeability to antibiotics

    • If functioning as an efflux pump component: direct extrusion of antimicrobials

    • If acting as a modifying enzyme: chemical inactivation of antibiotics

    • If involved in stress responses: enhanced survival during antibiotic exposure

    • If participating in biofilm formation: creating physical barriers to antibiotic penetration

  • Research Approaches:

    • Comparative proteomics between susceptible and resistant isolates to assess MG456 expression levels

    • Genetic manipulation to assess phenotypic changes in antibiotic susceptibility

    • Structure-function studies to identify potential antibiotic binding or modification sites

    • Temporal expression analysis during antibiotic exposure

  • Clinical Implications:

    • Potential development of diagnostic markers for resistance if MG456 involvement is confirmed

    • Identification of novel therapeutic targets to combat resistant strains

    • Understanding of resistance evolution across different geographical regions, as MG prevalence varies significantly (10.0-22.1% depending on population)

  • Interdisciplinary Connections:

    • Integration with surveillance data on resistance patterns

    • Correlation with treatment outcomes in different populations

    • Consideration of co-infections that may influence resistance development, such as Chlamydia trachomatis, Neisseria gonorrhoeae, and Trichomonas vaginalis

  • Future Therapeutic Strategies:

    • MG456-targeted inhibitors if confirmed as a resistance factor

    • Combination therapies addressing both known and novel resistance mechanisms

    • Approaches to restore antibiotic susceptibility in resistant strains

Research in this area is particularly urgent given the high prevalence of antimicrobial resistance in M. genitalium and the limited treatment options currently available for resistant infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.