Recombinant Mycoplasma hyopneumoniae ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

ATP Synthase and Subunit b

ATP synthase is a vital enzyme complex found in the membranes of bacteria, mitochondria, and chloroplasts. It harnesses the energy from a proton gradient to synthesize ATP from adenosine diphosphate (ADP) and inorganic phosphate. ATP synthase consists of two main components:

  • F1: The catalytic core where ATP synthesis occurs.

  • F0: The membrane-spanning portion that allows protons to flow across the membrane, driving the rotation of the complex and ATP synthesis.

Subunit b (atpF) is a crucial part of the F0 complex, acting as a stalk that connects the F1 and F0 components. It helps stabilize the ATP synthase complex and is essential for its function.

Mycoplasma hyopneumoniae

Mycoplasma hyopneumoniae is a bacterium that infects pigs and causes enzootic pneumonia (EP) . It is a widespread and economically significant respiratory disease in the swine industry. M. hyopneumoniae lacks a cell wall, which is a characteristic feature of mycoplasmas . This absence of a cell wall contributes to its resistance to certain antibiotics.

Recombinant Production

Recombinant proteins are produced by introducing the gene encoding the protein of interest into a host organism, such as E. coli, which then expresses the protein . The recombinant protein can then be isolated and purified for research or diagnostic purposes. Recombinant Mycoplasma hyopneumoniae ATP synthase subunit b (atpF) can be used in various applications:

  • Research: Studying the structure, function, and interactions of the ATP synthase complex in M. hyopneumoniae.

  • Diagnostics: Developing diagnostic assays to detect M. hyopneumoniae infections in pigs.

  • Vaccine Development: Investigating its potential as a vaccine candidate to prevent enzootic pneumonia.

Potential Role in Diagnostics

The ATP synthase beta subunit (AtpD) of Mycoplasma pneumoniae has been identified and evaluated for its usefulness in the development of serological assays . Studies have shown that recombinant AtpD (rAtpD) protein is recognized by serum samples from M. pneumoniae-infected patients . Combining rAtpD and rP1-C (recombinant C-terminal fragment of the P1 adhesin) can effectively differentiate between patients infected with M. pneumoniae and healthy individuals for the IgM class . This suggests that AtpD can be used as an antigen for the immunodiagnosis of early and acute M. pneumoniae infection in association with adhesin P1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; MHP7448_0049; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Mycoplasma hyopneumoniae (strain 7448)
Target Names
atpF
Target Protein Sequence
MVNLNQSLGDLFKGIIPNVYVLGATIVSFLVLFLFITYFVYRPLKKYIKKRKDFLQNHID LTIKSNVEAEKLEKKSQQKLLETKEFCIELKEKSQIEANKFLEDAKKTAIDNARQLINEG QKVLLEYENEIKSKYYMNVINVAVEICQKYLEKQDKNNKILQQSLIADLEKELRKRENSS KKKDNFGK
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This protein is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of ATP synthase genes in M. hyopneumoniae?

M. hyopneumoniae contains two distinct ATP synthase operons: a typical Type 1 F₁F₀ ATPase (MHP_RS00240-MHP_RS00280) and a specialized mycoplasma-specific F₁-like ATPase (MHP_RS02445-MHP_RS02475). The F₁-like ATPase operon encodes alpha and beta subunits (MHP_RS02445 and MHP_RS02450) along with several hypothetical proteins that may contribute to the formation of a functional complex . Interestingly, one of these hypothetical genes, MHP_RS02465, potentially resembles the γ-subunit of the F₁-like ATPase based on structural analysis . The atpF gene encoding subunit b would typically be associated with the F₀ portion of the ATP synthase complex, though its specific organization in M. hyopneumoniae requires further characterization.

How does the F₁-like ATPase in M. hyopneumoniae differ from conventional bacterial F₁F₀ ATP synthases?

The mycoplasma-specific F₁-like ATPase originated in the Hominis group of mycoplasma species and differs structurally from conventional bacterial ATP synthases . Unlike typical F₁F₀ complexes that consist of both membrane-embedded (F₀) and cytoplasmic (F₁) components, the F₁-like ATPase appears to have evolved specialized components. Several hypothetical proteins in this operon are predicted to be membrane-associated, suggesting a unique membrane interaction mechanism . The functional implications of these structural differences remain under investigation, but current evidence suggests the F₁-like ATPase may provide protection against pH stress by transporting protons across the plasma membrane during infection .

What is known about ATP synthase expression during M. hyopneumoniae infection?

Transcriptome analysis comparing in vivo versus in vitro growth conditions reveals that six out of seven genes in the F₁-like ATPase operon are significantly up-regulated during infection . This suggests the F₁-like ATPase plays an important role in adaptation to the host environment. Specifically, genes encoding the alpha and beta subunits (MHP_RS02445 and MHP_RS02450) and four hypothetical genes in this operon showed increased expression in lung tissue compared to laboratory culture conditions . In contrast, genes in the operon encoding the typical Type 1 F₁F₀ ATPase did not show differential expression between in vivo and in vitro conditions, highlighting the potential specialized function of the F₁-like ATPase during infection .

What expression systems are recommended for recombinant M. hyopneumoniae ATP synthase components?

For expressing recombinant M. hyopneumoniae proteins, researchers should consider codon optimization for the chosen expression system due to the organism's low G+C content. E. coli-based expression systems using vectors with tightly controlled induction mechanisms (such as pET or pBAD series) are generally suitable for initial attempts. When expressing membrane-associated components like subunit b, consider using specialized strains like C41(DE3) or C43(DE3) that are designed for membrane protein expression. For difficult-to-express proteins, alternative systems like cell-free expression or eukaryotic systems (yeast or insect cells) may be necessary to obtain properly folded, functional protein.

What are the key challenges in purifying recombinant ATP synthase subunits from M. hyopneumoniae?

Purification of recombinant ATP synthase components presents several challenges, particularly for membrane-associated subunits like atpF. Membrane proteins typically require detergent solubilization, which can affect protein structure and function. When working with M. hyopneumoniae proteins, researchers should: (1) Test multiple detergents (mild non-ionic detergents like DDM or LMNG are good starting points); (2) Consider adding stabilizing agents such as glycerol or specific lipids; (3) Optimize buffer conditions to maintain protein stability; and (4) Employ affinity tags positioned to minimize interference with protein folding or function. Protein-specific purification protocols may need to be developed through systematic optimization of these parameters.

How can I verify the structural integrity of purified recombinant atpF?

Verification of structural integrity should employ multiple complementary techniques. Circular dichroism (CD) spectroscopy can assess secondary structure elements and thermal stability. Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine oligomeric state and homogeneity. Limited proteolysis followed by mass spectrometry can identify correctly folded domains. For membrane proteins like atpF, functional assays such as liposome reconstitution followed by proton pumping measurements provide the strongest evidence of proper folding. Negative-stain electron microscopy can also provide valuable information about protein shape and aggregation state before proceeding to more advanced structural studies.

What methods are available to study the function of F₁-like ATPase in M. hyopneumoniae?

Functional characterization of the F₁-like ATPase can be approached through several complementary methods. ATP hydrolysis activity can be measured using colorimetric assays (such as malachite green) to detect released phosphate. For in vivo relevance, researchers should compare activity under various pH conditions, as this ATPase may function in pH homeostasis during infection . Proton transport can be assessed by reconstituting purified components into liposomes loaded with pH-sensitive fluorescent dyes. Site-directed mutagenesis of conserved residues can identify functionally critical regions. For physiological studies, researchers can develop conditional knockdown strains using antisense RNA approaches, as genetic manipulation of essential genes in M. hyopneumoniae is challenging.

How does the F₁-like ATPase contribute to M. hyopneumoniae pathogenesis?

Based on transcriptome analysis, the F₁-like ATPase appears to play a significant role during infection, with six out of seven genes in this operon being up-regulated in vivo . This up-regulation suggests adaptation to the host environment, potentially by helping the bacterium manage pH stress encountered in the porcine respiratory tract . The F₁-like ATPase may contribute to pathogenesis by: (1) Maintaining intracellular pH homeostasis; (2) Contributing to energy generation under host-specific conditions; (3) Potentially interacting with components of the standard ATPase to form novel functional complexes . The ability to maintain proton gradients across the membrane may be particularly important for a wall-less pathogen that forms intimate associations with host tissues.

What protein-protein interactions are critical for F₁-like ATPase function?

Investigating protein-protein interactions within the F₁-like ATPase complex is essential for understanding its assembly and function. Several approaches can be employed: (1) Co-immunoprecipitation using antibodies against known components like the alpha or beta subunits; (2) Bacterial two-hybrid assays to screen for direct interactions between components; (3) Cross-linking mass spectrometry to identify interaction interfaces; (4) Cryo-electron microscopy of the purified complex to determine structural arrangement. Of particular interest is how hypothetical proteins in the operon (such as MHP_RS02455, MHP_RS02470, and MHP_RS02475) contribute to complex formation, as they may represent novel components not found in conventional ATP synthases .

How might the F₁-like ATPase interact with other cellular systems during infection?

The up-regulation of F₁-like ATPase genes during infection suggests coordination with other cellular processes . Researchers should investigate potential interactions with: (1) Nutrient acquisition systems, especially those involved in glycerol-3-phosphate transport, which is also up-regulated in vivo; (2) Nucleotide metabolism pathways that show altered expression during infection; (3) Stress response mechanisms that help the bacterium survive host defense systems . Multi-omics approaches combining transcriptomics, proteomics, and metabolomics data from infected tissues can help identify these functional connections. Particular attention should be paid to potential interactions with down-regulated pathways like glycerol uptake, cell division, and alternative carbon metabolism, as these suggest metabolic reprogramming during infection .

Could the F₁-like ATPase represent a target for antimicrobial development?

Given its up-regulation during infection and potential role in host adaptation, the F₁-like ATPase represents a promising antimicrobial target . Research approaches should include: (1) High-throughput screening of compound libraries against purified F₁-like ATPase components; (2) Structure-based drug design targeting unique features not present in host ATP synthases; (3) Evaluation of compounds that disrupt assembly of the complex rather than just inhibiting enzymatic activity; (4) Assessment of specificity against other bacterial ATP synthases to minimize off-target effects. Initial screening can use ATPase activity assays, followed by testing promising compounds against live bacteria and eventually in infection models.

What RNA extraction protocols work best for studying ATP synthase gene expression in infected tissues?

Extracting sufficient bacterial RNA from infected tissues presents significant challenges due to the abundance of host RNA. Researchers have developed specialized protocols involving: (1) Flushing infected lung lobes followed by enrichment for bacterial RNA ; (2) Selective removal of host RNA through hybridization-based methods; (3) Optimization of RNA extraction buffers to maximize bacterial RNA recovery. Using these approaches, researchers have successfully obtained an average of 2.2 million bacterial reads per biological replicate, enabling robust analysis of the bacterial transcriptome during infection . When designing primers for RT-PCR validation, researchers should carefully consider the low G+C content of M. hyopneumoniae and the potential for cross-reactivity with host sequences.

What controls are essential when studying differential expression of ATP synthase genes?

Robust experimental design for studying ATP synthase gene expression requires several key controls: (1) Multiple biological replicates (minimum three) for both in vitro and in vivo conditions ; (2) Validation of RNA quality using bioanalyzer or similar methods; (3) Inclusion of spike-in controls to normalize for RNA extraction efficiency differences; (4) Validation of key genes using RT-qPCR with carefully designed primers; (5) Comparison across different growth phases in vitro to distinguish infection-specific from growth phase-dependent expression changes . Statistical analysis should employ appropriate multiple testing corrections, with stringent cutoffs (e.g., FDR < 0.01 and fold change > 2LOG2) to identify truly significant changes .

How can computational approaches enhance our understanding of ATP synthase function?

Computational methods offer powerful tools for studying ATP synthase components: (1) Homology modeling based on related structures can predict the arrangement of F₁-like ATPase components; (2) Molecular dynamics simulations can explore conformational changes during the catalytic cycle; (3) Machine learning approaches can identify potential functional partners based on co-expression patterns across multiple conditions ; (4) Genome-scale metabolic modeling can predict the impact of ATPase activity on cellular energetics. When applying these approaches to M. hyopneumoniae, researchers should account for the organism's unique metabolism and genome reduction. Integration of computational predictions with experimental validation creates a powerful iterative approach to understanding this complex system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.