Recombinant Mycoplasma mobile ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; MMOB2130; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Target Names
atpF
Target Protein Sequence
MLELGIFSSNTQNIGQSISERFAGIFPSWPIMLATLVSFTILLVVLTKLIYKPVKKMMKN RRDFIQNNIDESTKQVEKSNELLEKSNIEILDAKIKANTIIKDAQILAEEIKNNSIKDAK DKSKQLLEETKIYIRQQKVLFAKESKKEIVEIAGEMTKKILSESDVKLEDSKFLENLLKN DITK
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This subunit is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit b (atpF) in Mycoplasma mobile?

ATP synthase subunit b in M. mobile likely serves as a critical component of the stator structure that connects the F₁ catalytic domain to the F₀ membrane domain. Unlike typical bacterial ATP synthases, M. mobile's ATP synthase has evolved to function as part of a unique twin motor arrangement that contributes to the organism's gliding motility mechanism . The molecular motor discovered in M. mobile consists of a chain of two ATP synthase-like molecules housed within a complex cylindrical structure . Structurally, atpF likely contains a transmembrane domain and an extended alpha-helical region that forms part of the peripheral stator stalk, helping to prevent rotation of the catalytic portions during ATP synthesis or hydrolysis. This specialized adaptation represents a remarkable example of how a traditional energy-generating complex has been repurposed for a completely different cellular function.

How does the ATP synthase in M. mobile differ from typical bacterial ATP synthases?

The ATP synthase in M. mobile exhibits several distinctive features compared to typical bacterial ATP synthases. Most notably, M. mobile's ATP synthase appears to have been modified to function as part of a unique gliding machinery, featuring a twin motor arrangement where two ATP synthase-like complexes are connected together . This flower-like structure shares characteristics with traditional ATP synthase but has been adapted for mechanical motion rather than primarily for ATP production . While typical bacterial ATP synthases function primarily in energy production through the conversion of proton gradient energy to ATP, in Mycoplasma species, including M. mobile, the ATP synthase often functions in reverse—hydrolyzing ATP to maintain the electrochemical gradient . This reverse operation likely reflects the parasitic lifestyle of Mycoplasma, which obtains most of its energy from the host rather than through oxidative phosphorylation.

How does the atpF subunit contribute to the assembly and stability of the ATP synthase complex in M. mobile?

The atpF subunit likely plays a crucial role in the assembly and stability of the ATP synthase complex in M. mobile, particularly in the context of its specialized twin motor structure. Research on ATP synthase in other organisms has demonstrated that stator subunits are essential for maintaining the structural integrity of the complex. For example, in Toxoplasma gondii, depletion of the stator-like subunit ICAP2 led to the disassembly of the ATP synthase complex, with the β subunit shifting from a complex of approximately 900 kDa to a much smaller complex of around 100 kDa . Similar effects would likely occur if atpF were depleted in M. mobile. Additionally, the unique twin motor arrangement in M. mobile suggests that atpF may have specialized functions in stabilizing or connecting the paired ATP synthase-like complexes. The proper assembly of this structure is likely critical for both energy metabolism and the gliding motility that characterizes M. mobile.

What experimental approaches are most effective for studying the role of atpF in M. mobile's unique twin motor structure?

Several experimental approaches would be particularly valuable for investigating atpF's role in M. mobile's twin motor structure:

These approaches would collectively provide a comprehensive understanding of how atpF contributes to this unique molecular machine.

How might post-translational modifications affect the function of recombinant M. mobile atpF?

Post-translational modifications (PTMs) could significantly impact the function of recombinant M. mobile atpF, particularly when expressed in heterologous systems. Although specific PTMs for M. mobile atpF have not been characterized in detail, potential modifications could include:

  • Phosphorylation: ATP synthase subunits in various organisms undergo phosphorylation, which can regulate activity. Expression in bacterial systems might result in different phosphorylation patterns compared to the native protein.

  • Disulfide bond formation: If atpF contains cysteine residues, proper disulfide bond formation might be critical for its structure and function, and this could be affected by the redox environment of the expression system.

  • Membrane integration: Proper insertion into the membrane is crucial for atpF function, and different expression systems may vary in their ability to correctly integrate the protein into membranes.

  • Protein-lipid interactions: Specific lipid interactions may stabilize atpF in its native environment, and these might be absent in recombinant systems.

When working with recombinant atpF, researchers should consider these potential modifications and may need to perform additional characterization to determine how closely the recombinant protein mimics the native form in M. mobile.

What role does the ATP synthase-derived motor play in the evolutionary adaptation of M. mobile?

The ATP synthase-derived motor in M. mobile represents a remarkable evolutionary innovation that has likely contributed significantly to the organism's adaptation to its ecological niche. Research has shown that M. mobile uses a unique gliding motility mechanism that involves a twin motor structure evolved from ATP synthase components . This adaptation allows M. mobile to move rapidly (up to 7 μm per second) on solid surfaces, which may facilitate host colonization and nutrient acquisition in its parasitic lifestyle. The repurposing of ATP synthase, a highly conserved complex typically dedicated to energy metabolism, for mechanical movement illustrates the plasticity of cellular machinery during evolution. This transformation likely involved significant structural modifications to convert the rotary motion of ATP synthase into the linear gliding movement of M. mobile. The discovery of this mechanism provides important insights into how complex molecular machines can be adapted for entirely new functions during evolution and may inspire biomimetic approaches in nanotechnology .

What are the optimal expression systems for producing recombinant M. mobile ATP synthase subunit b?

Several expression systems could be considered for recombinant production of M. mobile atpF, each with distinct advantages:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli C41/C43(DE3)Specialized for membrane proteins, high yield potentialGenetic code differences, possible misfoldingLow temperature induction (16-20°C), inclusion of lipids in growth medium
Cell-free expressionDirect incorporation into liposomes or nanodiscs, avoids toxicity issuesExpensive, lower scalabilityOptimization of lipid composition, addition of chaperones
Pichia pastorisBetter for complex eukaryotic-like folding, efficient secretionLonger process, glycosylation may differMethanol induction optimization, expression as fusion protein
Insect cells (Sf9, Hi5)Superior folding for complex structuresTechnically demanding, costlyOptimization of MOI, harvest time, and temperature

When expressing M. mobile atpF, researchers must address the mycoplasma-specific genetic code where UGA codes for tryptophan rather than a stop codon . This can be resolved either by site-directed mutagenesis to replace UGA codons or by using specialized strains with modified translational machinery. For structural and functional studies, maintaining the native conformation is critical, potentially requiring co-expression with other ATP synthase subunits to promote proper folding and assembly.

What purification strategies yield the highest purity and functional integrity for recombinant M. mobile atpF?

Effective purification of recombinant M. mobile atpF requires strategies tailored to membrane proteins while preserving functional integrity:

  • Membrane isolation and solubilization: Gentle extraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin preserves structural integrity better than harsh detergents like SDS.

  • Affinity chromatography: Fusion tags such as His6, Strep-II, or FLAG facilitate selective capture. For atpF, C-terminal tags are often preferable to avoid interfering with membrane insertion.

  • Size exclusion chromatography: Essential for separating properly folded protein from aggregates and removing detergent micelles. This step also allows buffer exchange into conditions optimal for functional studies.

  • Ion exchange chromatography: Provides additional purification based on atpF's charge properties, particularly useful for removing contaminants with similar size but different charge characteristics.

  • Reconstitution: For functional studies, incorporation into liposomes or nanodiscs after purification may be necessary to restore a native-like membrane environment.

Throughout purification, it's critical to maintain a stable lipid environment and avoid conditions that might disrupt the protein's structure, such as extreme pH, high salt, or elevated temperatures.

How can researchers assess the proper folding and functional integrity of recombinant M. mobile atpF?

Multiple complementary techniques can assess the folding and functional integrity of recombinant M. mobile atpF:

  • Structural assessment:

    • Circular dichroism spectroscopy to verify secondary structure content, particularly the expected alpha-helical character

    • Thermal shift assays to measure protein stability and optimize buffer conditions

    • Limited proteolysis to identify properly folded domains resistant to digestion

    • Size exclusion chromatography profiles to distinguish between monomeric, oligomeric, and aggregated states

  • Functional assessment:

    • Binding assays with interaction partners from the ATP synthase complex

    • Reconstitution experiments with ATP synthase subcomplexes to test stator function

    • Assembly assays to determine if recombinant atpF can incorporate into higher-order structures

  • Specialized techniques for M. mobile context:

    • Assays to test incorporation into the twin motor structure characteristic of M. mobile

    • Functional tests related to gliding motility if using intact cell systems

    • High-speed AFM to visualize dynamic structural changes in the reconstituted complex

These approaches collectively provide a comprehensive assessment of whether recombinant atpF maintains its native structural and functional properties.

What analytical techniques are most suitable for characterizing the structure of recombinant M. mobile atpF?

Several analytical techniques are particularly valuable for structural characterization of recombinant M. mobile atpF:

For the most comprehensive structural understanding, a combination of these techniques would ideally be employed, with particular emphasis on approaches that can capture the unique twin motor arrangement characteristic of M. mobile.

What are the best approaches for reconstituting functional M. mobile ATP synthase complexes with recombinant subunits?

Reconstituting functional M. mobile ATP synthase complexes with recombinant subunits requires careful consideration of membrane environment and assembly:

  • Membrane mimetics selection:

    • Liposomes formed from lipid mixtures mimicking M. mobile's native membrane composition

    • Nanodiscs for a more controlled lipid environment and better accessibility for structural studies

    • Amphipols or SMALPs (styrene maleic acid lipid particles) for maintaining native lipid interactions

  • Reconstitution strategies:

    • Co-expression of multiple subunits often yields better results than combining individually purified components

    • Sequential addition of subunits following the natural assembly pathway

    • Cell-free expression directly into liposomes for membrane proteins like atpF

  • M. mobile-specific considerations:

    • For reconstituting the twin motor structure , specialized approaches may be needed

    • The flower-like arrangement may require specific lipid compositions or additional factors

    • High-speed AFM could monitor the assembly process in real-time

  • Functional verification:

    • ATP hydrolysis/synthesis assays to confirm enzymatic activity

    • Proton pumping measurements in reconstituted vesicles

    • For motor function, micro-mechanical assays may be developed to assess force generation

Given the unique adaptation of M. mobile's ATP synthase for gliding motility , reconstitution approaches may need to be modified from those used for conventional ATP synthases.

Key Discoveries About M. mobile's ATP Synthase-Based Twin Motor

Recent research has revealed several groundbreaking findings about M. mobile's unique molecular motor:

  • The motor consists of a chain of two ATP synthase-like molecules housed within a complex cylindrical structure . This twin motor arrangement is unprecedented in biological systems.

  • The motor appears to have evolved from a protein that synthesizes ATP, called ATP synthase, though with significant modifications for its new role in motility .

  • The flower-like structure, colored red and yellow in schematic representations, shares structural features with ATP synthase , suggesting evolutionary modification rather than development of an entirely new structure.

  • Unlike respiratory systems in mitochondria, M. mobile converts ATP energy directly into a gliding force with a rotary class of ATP synthase .

  • This discovery represents a breakthrough in understanding protein evolution and offers insights into the operating principles of biological motility mechanisms .

  • The unique structure may serve as a basis for the development of nanoscale devices and potentially pharmaceuticals targeting these specialized structures .

These findings highlight how a highly conserved cellular component has been repurposed during evolution to create a novel molecular machine with entirely different functionality.

Comparison of ATP Synthase Features Across Mycoplasma Species

SpeciesATP Synthase CharacteristicsNotable FeaturesEvolutionary Implications
M. mobileTwin motor structure for gliding motility Chain of two ATP synthase-like molecules in a cylindrical structure Repurposing of ATP synthase for mechanical motion
Various mycoplasmasExtra copies of atpA and atpD genes outside main operon Gene pairs appear to have been spread by horizontal gene transfer Unexpected gene redundancy despite reduced genomes
All mycoplasmasComplete F₁F₀ ATPase operon encoding eight subunits Similar organization to other bacteria like E. coli Conservation of essential energy metabolism machinery
Most mycoplasmasATP synthase functions primarily in ATP hydrolysisMaintains electrochemical gradient rather than ATP synthesis Adaptation to parasitic lifestyle

This comparison highlights the evolutionary plasticity of ATP synthase across mycoplasma species, with M. mobile representing perhaps the most dramatic example of functional adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.