The atpE subunit is part of a modified ATP synthase complex that powers M. mobile’s gliding motility. Unlike canonical ATP synthases, which generate ATP via proton motive force, this complex likely hydrolyzes ATP to drive movement. Structural studies reveal a twin-motor architecture, where two ATP synthase-like molecules form a cylindrical structure linked to surface adhesins . This adaptation suggests a shared evolutionary origin with ATP synthases but repurposed for motility .
Phylogenomic analyses identify atpE-encoding clusters as part of F₁-like ATPase systems in mycoplasmas. These clusters, including atpE, exhibit rapid sequence evolution while retaining conserved structural features. Horizontal gene transfer (HGT) between mycoplasmas in shared hosts may explain the spread of these clusters, particularly in the Hominis group .
Functional Studies: Recombinant atpE is used to investigate ATP synthase subunit interactions and rotary mechanisms .
Proteomic Analyses: Despite its predicted presence in M. mobile, native atpE is challenging to detect, necessitating recombinant production for validation .
The detection of native atpE in M. mobile remains problematic, as proteomic studies have not identified it despite genomic predictions . This highlights the need for advanced techniques like cryo-EM or high-speed AFM to resolve its structural dynamics . Additionally, understanding the molecular mechanism of ATP hydrolysis in the twin-motor complex requires further biochemical characterization .
KEGG: mmo:MMOB2140
STRING: 267748.MMOB2140
ATP synthase subunit c (atpE) in Mycoplasma mobile is a 99-amino acid protein that forms part of the F0 sector of the ATP synthase complex. The full amino acid sequence is: MNDLITNLALPQEVINAAGSNNGAGIGYGLVAVGAGLAMIGALGTGLGQGVSAGKAAEAV GRNPEAEAKIRLMMIIGMGIAETAAIYSLIIAILLIFVY . This highly hydrophobic protein contains membrane-spanning regions that assemble into a ring structure within the membrane. The protein has a molecular weight of approximately 8-10 kDa and contains characteristic transmembrane helices connected by hydrophilic loops. When studying this protein, researchers should consider its hydrophobic nature when designing purification strategies, typically employing detergents to maintain protein solubility during isolation procedures.
The atpE protein functions as a critical component of the F0 sector of ATP synthase, forming an oligomeric c-ring embedded in the membrane. In M. mobile, ATP synthase appears to be the only ATP production method through fermentation of sugars, making atpE essential for cellular energetics . The c-ring participates in proton translocation across the membrane, which drives the conformational changes in the F1 sector necessary for ATP synthesis.
When investigating atpE function, researchers should establish proton gradient measurements using techniques such as pH-sensitive fluorescent probes or patch-clamp electrophysiology. Mutational analysis targeting conserved proton-binding residues can further elucidate the specific contribution of atpE to ATP synthesis in M. mobile. Unlike other bacteria with multiple energy production pathways, M. mobile's reliance on this system makes it a particularly interesting model for studying minimal energy production systems.
Escherichia coli has proven to be an effective heterologous expression system for recombinant M. mobile atpE protein . Successful expression typically employs a vector containing an N-terminal His-tag for subsequent purification. When designing expression protocols, researchers should consider:
Optimizing codon usage for E. coli, as mycoplasmas use the universal stop codon UGA as a tryptophan codon
Using specialized E. coli strains designed for membrane protein expression (e.g., C41/C43 or Lemo21)
Employing inducible promoter systems with careful optimization of induction conditions (typically low temperature induction at 18-25°C)
Including protease inhibitors during cell lysis to prevent degradation
Alternative expression systems such as cell-free protein synthesis may be considered for challenging membrane proteins like atpE, potentially offering advantages for functional studies by allowing direct incorporation into liposomes.
Purification of recombinant His-tagged atpE protein can be achieved using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography. The following protocol has been shown to yield high purity product :
Lyse cells in Tris/PBS-based buffer containing appropriate detergents (typically n-dodecyl-β-D-maltoside or CHAPS)
Purify using Ni-NTA resin with imidazole gradient elution
Further purify via size exclusion chromatography
Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0
For optimal activity maintenance, purified protein should be stored at -20°C/-80°C and repeated freeze-thaw cycles should be avoided. When reconstituting the lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL and consider adding glycerol (final concentration 5-50%) for long-term storage .
Multiple complementary techniques should be employed for comprehensive structural characterization of M. mobile atpE:
Circular Dichroism (CD) Spectroscopy: Valuable for assessing secondary structure content and stability in different detergent environments
Nuclear Magnetic Resonance (NMR): Particularly suitable for smaller membrane proteins like atpE to obtain atomic-level structural information in a lipid environment
Cryo-Electron Microscopy: Increasingly used for membrane protein complexes to visualize the entire ATP synthase complex with atpE in its native oligomeric state
X-ray Crystallography: Challenging for membrane proteins but can provide high-resolution structural data if suitable crystals can be obtained
When conducting structural studies, researchers should consider the native lipid environment of M. mobile and potentially incorporate native-like lipids during analysis to maintain physiologically relevant conformations.
When comparing M. mobile atpE with other species such as M. pneumoniae, researchers should focus on:
Analyzing sequence conservation at proton-binding sites
Examining differences in oligomerization patterns of the c-ring
Investigating species-specific protein-protein interactions within the ATP synthase complex
Assessing adaptations that might relate to the specialized function in gliding motility
Table 1: Comparison of ATP Synthase Components Across Selected Mycoplasma Species
| Species | ATP Synthase Subunit | Size (amino acids) | Unique Features | Related Function |
|---|---|---|---|---|
| M. mobile | atpE (subunit c) | 99 | Adapted for integration with gliding machinery | ATP production, possibly motility |
| M. pneumoniae | AtpD (beta subunit) | 476* | Serologically relevant | ATP production, diagnostic marker |
| Other mycoplasmas | Various | Variable | Species-specific adaptations | Primary energy production |
*Note: This comparison includes different subunits of the ATP synthase complex across species based on available data in the search results.
Measuring enzymatic activity of recombinant atpE requires reconstitution into a functional ATP synthase complex or proteoliposomes. The following methodological approaches are recommended:
Reconstitution into proteoliposomes with other ATP synthase subunits
Establishment of a proton gradient using valinomycin/KCl
Measurement of ATP synthesis using luciferin/luciferase assays
Alternative assessment through proton translocation assays using pH-sensitive fluorescent dyes
For quantitative analysis, researchers should establish standard curves with known ATP concentrations and validate reconstitution efficiency using freeze-fracture electron microscopy or dynamic light scattering to confirm proper incorporation into liposomes.
M. mobile exhibits a unique ATP-powered gliding motility that distinguishes it from many other mycoplasma species. Research indicates that the ATP synthase components, including atpE, have evolved specialized functions potentially related to this motility mechanism . The internal structure of M. mobile's gliding machinery consists of a bell-like rigid structure and chains of twin motors that evolved from F-type ATP synthase .
To investigate this relationship, researchers should:
Perform protein-protein interaction studies to identify binding partners between atpE and gliding machinery components
Conduct site-directed mutagenesis of atpE to assess effects on both ATP synthesis and gliding motility
Use high-resolution microscopy (TIRF, super-resolution) to visualize co-localization of fluorescently labeled atpE with gliding machinery components
Develop in vitro motility assays to directly assess the contribution of purified atpE to reconstituted gliding complexes
This represents an exciting frontier in mycoplasma research, as understanding the dual role of ATP synthase components in both energy production and motility could reveal novel molecular mechanisms.
While M. pneumoniae ATP synthase beta subunit (AtpD) has been successfully used for serological diagnosis , similar approaches could be developed using M. mobile atpE. Researchers investigating diagnostic applications should:
Express and purify recombinant atpE with optimal antigenicity (maintaining native conformational epitopes)
Assess cross-reactivity with other mycoplasma species through western blotting and ELISA
Develop and validate ELISA protocols using panels of serum samples
Consider combining multiple recombinant antigens (e.g., atpE with adhesion proteins) to improve diagnostic sensitivity and specificity
The methodological approach should include validation against gold standard diagnostic tests and determination of appropriate cutoff values for different antibody classes (IgM, IgG, IgA) to distinguish acute from past infections.
Advanced bioinformatic analyses can reveal evolutionary insights into M. mobile atpE. Researchers should employ:
Phylogenetic analysis comparing atpE sequences across diverse bacterial phyla, with special attention to mycoplasma lineages
Molecular dynamics simulations to analyze structural stability and conformational changes under different conditions
Positive selection analysis to identify amino acid positions under evolutionary pressure
Ancestral sequence reconstruction to trace the evolutionary trajectory of specialized functions
Genomic analysis shows that M. mobile contains 635 genes, with 109 genes specific to M. mobile not found in other mycoplasmas, and 35 genes present in M. mobile and other organisms but not in other mycoplasmas . This distribution pattern suggests unique evolutionary adaptations that may include specialized functions of ATP synthase components.
Researchers working with recombinant M. mobile atpE face several technical challenges:
Low expression levels: Optimize codon usage and use specialized expression strains designed for membrane proteins
Protein aggregation: Carefully screen detergents and lipid compositions to maintain native-like environment
Loss of activity during purification: Minimize exposure to harsh conditions and maintain appropriate pH and ionic strength
Reconstitution difficulties: Develop gradual detergent removal protocols using biobeads or dialysis to ensure proper incorporation into liposomes
Stability issues: Include stabilizing agents such as trehalose (6%) in storage buffers
When troubleshooting expression problems, systematic optimization of induction conditions (temperature, inducer concentration, duration) often yields significant improvements. For long-term storage, lyophilization followed by storage at -20°C/-80°C with the addition of 5-50% glycerol upon reconstitution has proven effective .
Ensuring experimental specificity when studying atpE function requires rigorous controls:
Include inactive mutants (e.g., mutations in proton-binding sites) as negative controls
Use specific inhibitors of ATP synthase (oligomycin, DCCD) to confirm observed effects are specifically related to atpE function
Perform complementation studies in knockout/knockdown systems to verify functional restoration
Include heterologous c-subunits from other bacteria as controls to identify M. mobile-specific effects
Researchers should also consider implementing inducible expression systems or conditional knockouts to enable temporal control of atpE expression, allowing for more precise determination of direct versus indirect effects in complex biological systems.
Several high-priority research directions should be considered for advancing our understanding of M. mobile atpE:
Cryo-EM structural analysis of the complete ATP synthase complex to resolve subunit interactions at high resolution
Investigation of potential moonlighting functions beyond ATP synthesis, particularly in relation to gliding motility
Systems biology approaches integrating metabolomics, proteomics, and transcriptomics to understand the regulatory networks involving atpE
Development of specific inhibitors targeting unique features of M. mobile atpE as potential antimicrobial agents
Researchers might also explore the potential role of atpE in adaptation to different environmental conditions, as M. mobile shows remarkable diversity in host environments despite its minimal genome .
Advanced genetic manipulation techniques offer powerful approaches for investigating atpE function:
Development of CRISPR-Cas9 systems optimized for the high AT content of mycoplasma genomes
Creation of conditional knockdowns using CRISPRi to enable studies of essential genes like atpE
Site-directed mutagenesis to introduce specific amino acid changes to test functional hypotheses
Integration of reporter genes to monitor expression and localization under different conditions
When designing genetic manipulation experiments in mycoplasmas, researchers must account for the unique genetic code usage where UGA encodes tryptophan rather than serving as a stop codon . Additionally, the minimal genome of M. mobile means that many genes are essential, necessitating conditional approaches rather than complete knockouts for functional studies.
Current research suggests that ATP synthase components in mycoplasmas, including M. mobile atpE, likely serve dual or multiple functions beyond their canonical roles in ATP production. The evidence for involvement in gliding motility represents a fascinating example of how minimal organisms evolve multifunctional proteins to compensate for limited genetic resources. M. mobile, with only 635 genes , demonstrates remarkable adaptability and specialization, with the ATP synthase complex potentially contributing to both energy metabolism and the unique cellular functions that allow this organism to thrive in its ecological niche.
Future research integrating structural biology, genetics, biochemistry, and systems approaches will continue to illuminate how these minimal organisms achieve functional complexity through protein moonlighting and specialized adaptations of conserved molecular machines.