Recombinant Mycoplasma mycoides subsp. mycoides SC ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Mycoplasma mycoides subsp. mycoides SC (Small Colony) is a bacterium that causes contagious bovine pleuropneumonia (CBPP) in cattle . The ATP synthase subunit b (atpF) is a component of the F1F0 ATP synthase, an enzyme essential for ATP production in bacteria . Recombinant atpF refers to the atpF protein produced using recombinant DNA technology, typically in a host organism like Escherichia coli .

Role of ATP Synthase in Mycoplasma mycoides SC

ATP synthase is vital for energy production in M. mycoides SC, similar to its role in most bacteria . The F1F0 ATP synthase complex consists of two main components: F1, which is the catalytic core, and F0, which is the membrane-spanning portion that facilitates proton transport . ATP synthase uses the proton-motive force generated across the cell membrane to synthesize ATP from ADP and inorganic phosphate .

Recombinant Production of atpF

Recombinant atpF is produced by cloning the atpF gene from M. mycoides SC into an expression vector and introducing this vector into a host organism like E. coli . The host organism then expresses the atpF gene, producing the atpF protein, which can be purified for research or diagnostic purposes . For example, Creative BioMart offers recombinant full-length Mycoplasma mycoides subsp. mycoides SC ATP synthase subunit b (atpF) protein (Q6MS90) (1-181aa) with an N-terminal His tag, expressed in E. coli .

Applications of Recombinant atpF

Recombinant atpF has several applications:

  1. Serological Diagnostics: Recombinant atpF can be used to develop serological assays for CBPP diagnosis . These assays detect antibodies against atpF in the serum of infected animals, indicating exposure to M. mycoides SC .

  2. Subunit Vaccines: Recombinant atpF can be explored as a potential subunit vaccine candidate . By vaccinating cattle with recombinant atpF, the animals may develop an immune response that protects them against subsequent M. mycoides SC infection .

  3. Structural and Functional Studies: Recombinant atpF allows researchers to study the structure and function of the ATP synthase complex in M. mycoides SC . This can provide insights into the unique adaptations of mycoplasmas and identify potential drug targets .

  4. Drug Discovery: Targeting ATP synthase, including the atpF subunit, is a strategy for developing new antibacterial drugs . Inhibitors of ATP synthase can disrupt ATP production, leading to cell death .

Immunoproteomic Identification

Recombinant proteins like atpF are valuable in immunoproteomics to identify potential diagnostic markers . For instance, recombinant surface proteomics has been used to analyze humoral immune responses in cattle infected with M. mycoides SC, where atpF is among the surface proteins expressed and analyzed .

Tables of Related Proteins

ProteinGeneDescription
ATP synthase alpha subunitatpAPart of the F1 complex; binds ATP and participates in catalysis
ATP synthase beta subunitatpDPart of the F1 complex; contains the catalytic site for ATP synthesis
ATP synthase gamma subunitatpGCentral stalk of the ATP synthase; interacts with the alpha and beta subunits
ATP synthase delta subunitatpHPart of the F1 complex; connects the F1 and F0 components
ATP synthase epsilon subunitatpEPart of the F1 complex; involved in regulating ATP synthase activity
Subunit aatpIPart of the F0 complex; forms the proton channel
Subunit catpCPart of the F0 complex; forms the rotor that turns during ATP synthesis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; MSC_0889; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Mycoplasma mycoides subsp. mycoides SC (strain PG1)
Target Names
atpF
Target Protein Sequence
MLFQGFNVVINATTQGVPKIVESLFPNLPNFIAHLLATIILVIVLTKLVYKPYKQMIEKQ TQKITEVLSDAIEKQTQANIKIKQANTLLEDAKTESVSILKTARIDAEIQKNKIIDNANL QAKNIQSYAQNSIKQEKIKAQLEIKNTIVNLAINSAEKILNKEIDKNTNKQLIEEFIKEL D
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This product is a component of the F0 channel, forming part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural organization of F1F0 ATPase in Mycoplasma mycoides subsp. mycoides SC?

The F1F0 ATPase in Mycoplasma mycoides subsp. mycoides SC shares structural similarities with that found in other bacteria, including E. coli. The complex contains a complete operon encoding eight subunits that form the characteristic two-sector structure: the membrane-embedded F0 sector and the catalytic F1 sector . The F0 sector typically includes the a, b, and c subunits, with the b subunit (encoded by atpF) forming part of the peripheral stalk that connects F0 to the F1 sector. The F1 sector consists of α, β, γ, δ, and ε subunits arranged in a characteristic (αβ)3 hexameric structure with central and peripheral stalks .

What makes mycoplasma F1F0 ATPases particularly interesting is their evolutionary context. Despite the general trend of gene loss and redundancy elimination during mycoplasma evolution, many mycoplasma species have retained extra copies of atpA and atpD (encoding α and β subunits, respectively) located outside the main F1F0 ATPase operon . These extra copies are organized in pairs and appear to have been subject to horizontal gene transfer between different mycoplasma species .

How does the function of F1F0 ATPase differ in mycoplasmas compared to other bacteria?

Despite this functional shift, the genes encoding the subunits of the F1F0 ATPase complex are considered essential in several mycoplasma species based on global transposon mutagenesis studies . This essentiality underscores the critical role of the F1F0 ATPase in mycoplasma physiology, particularly in maintaining membrane potential and cellular homeostasis.

What are the unique characteristics of ATP synthase subunit b (atpF) in mycoplasmas?

While specific information about ATP synthase subunit b in Mmm SC is limited in the available research, general principles about this component can be inferred from studies of F1F0 ATPases in mycoplasmas and other bacteria. The b subunit forms part of the peripheral stalk of the F1F0 ATPase complex, connecting the membrane-embedded F0 sector with the catalytic F1 sector . This stalk is essential for anchoring the (αβ)3 hexamer to the membrane, enabling the enzyme to function properly.

Interestingly, some mycoplasma species possess gene clusters encoding F1-like ATPases that lack homologs of certain components, including the b subunit, which are typically considered essential for the formation of the peripheral stalk in conventional F1F0 ATPases . These F1-like ATPases with modified structures suggest functional innovations in these minimalist organisms. Without a peripheral stalk to anchor the (αβ)3 complex to the membrane, these enzymes likely function solely as ATPases rather than ATP synthases .

What are the most effective expression systems for producing recombinant ATP synthase components from Mycoplasma mycoides subsp. mycoides SC?

Based on research with other mycoplasma membrane proteins, effective expression of recombinant ATP synthase components requires careful consideration of several factors:

  • Codon optimization: Mycoplasmas use a non-standard genetic code where the UGA codon codes for tryptophan instead of serving as a stop codon. For heterologous expression in standard systems, all UGA codons must be mutagenized to TGG, as demonstrated in the expression of GlpO from Mmm SC .

  • Expression vector selection: For optimal expression of active recombinant proteins, specialized vectors may be required. In the case of GlpO, researchers created a linearized vector pETHIS-1m harboring appropriate restriction sites to facilitate the creation of fusion proteins with optimal tag placement .

  • Fusion tag design: The placement and type of fusion tags can significantly affect protein function. For GlpO, researchers found that a C-terminal polyhistidine tag yielded more enzymatically active protein under in vitro conditions compared to proteins with tags at both N-terminal and C-terminal ends . This principle may apply to ATP synthase components as well.

  • Expression host selection: E. coli-based expression systems are commonly used but may require modifications for optimal expression of mycoplasma proteins. For specific applications, expression in mycoplasma hosts may be preferred, utilizing genetic tools developed for Mmm SC, including replicative oriC plasmids and transposon-based mutagenesis methods .

  • Purification under native conditions: For functional studies, purification under native conditions is essential to maintain protein activity. This approach has been used successfully for recombinant mycoplasma membrane proteins like GlpO and should be applied to ATP synthase components as well .

What purification strategies yield functional recombinant ATP synthase subunits?

Purification strategies for functional recombinant ATP synthase subunits should consider the following approaches:

  • Affinity chromatography: Histidine-tagged proteins can be purified using nickel affinity chromatography. A 10xHis-tagged C-terminus has been shown to allow effective purification while maintaining enzymatic activity for other mycoplasma membrane proteins .

  • Native conditions preservation: Maintaining native conditions throughout the purification process is crucial for preserving protein function. This includes careful selection of buffer components, pH, and temperatures that support protein stability and activity .

  • Oligomerization assessment: Many ATPase components naturally form oligomers, which can affect purification strategies. Immunoblot analysis can reveal the presence of monomeric and multimeric forms, as demonstrated for GlpO, which showed both 45 kDa monomeric and 90 kDa dimeric forms .

  • Quality control measures: Spectroscopic analysis can verify proper cofactor binding or structural integrity. For ATPase components, this might involve assessing nucleotide binding characteristics. Additionally, immunoblot analysis using appropriate antibodies (such as anti-His antibodies for tagged proteins) can confirm the presence and purity of the target protein .

  • Functional validation: For ATP synthase components, functional validation might include assessing ATP binding, ATP hydrolysis activity, or the ability to assemble with other subunits to form functional complexes. Activity assays should be performed with optimal protein concentrations, as determined through titration experiments .

Purification ParameterRecommended ApproachExample from Research
Affinity TagC-terminal polyhistidine tag10xHis-tagged C-terminus for recombinant GlpO showed higher activity than dual-tagged protein
Purification MethodNickel affinity chromatography under native conditionsSuccessfully used for GlpO and GlpOΔFAD while maintaining functional properties
Quality AssessmentImmunoblot analysis with appropriate antibodiesAnti-His antibodies revealed monomer (45 kDa) and dimer (90 kDa) forms of GlpO
Functional ValidationEnzyme-specific activity assaysFor GlpO, activity was measured by H2O2 production at 20 μg/mL protein concentration
Membrane Protein ExtractionSonication for membrane-enriched fractionsUsed for isolating membrane ATPase activity from Mmm SC cultures

What methods can detect protein-protein interactions between ATP synthase subunits?

Studying protein-protein interactions between ATP synthase subunits requires specialized approaches suitable for membrane protein complexes:

  • Co-immunoprecipitation: Using antibodies against one subunit to precipitate the entire complex, followed by immunoblotting to detect associated subunits. This approach could identify interactions between atpF and other F1F0 ATPase components.

  • Chemical cross-linking: Cross-linking reagents can covalently link interacting proteins, which can then be identified by mass spectrometry. This approach is particularly valuable for capturing transient or weak interactions within the ATPase complex.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these systems can detect binary interactions between different subunits when expressed in an appropriate host.

  • Native gel electrophoresis: Blue native PAGE can preserve protein complexes during electrophoresis, allowing visualization of intact F1F0 ATPase complexes and subcomplexes.

  • Reconstitution experiments: Mixing purified recombinant subunits and assessing complex formation and activity can provide functional evidence of protein-protein interactions. For ATP synthase, reconstitution might involve combining various subunits and measuring ATPase activity or proton pumping.

How can researchers assess the functional integrity of recombinant ATP synthase subunits?

Assessing the functional integrity of recombinant ATP synthase subunits involves multiple complementary approaches:

  • Enzymatic activity assays: For ATPase components, measuring ATP hydrolysis activity is the most direct assessment of function. This can be done using membrane-enriched fractions or purified protein complexes and quantifying the release of inorganic phosphate or other indicators of ATP hydrolysis .

  • Structural integrity assessment: Immunoblot analysis can reveal the presence of expected protein bands, including monomers and multimers. Native PAGE can be used to assess the formation of higher-order complexes, which is particularly relevant for ATP synthase components that function as part of a multi-subunit complex .

  • Spectroscopic analysis: For components that bind cofactors or substrates, spectroscopic methods can confirm proper binding. While ATP synthase subunits do not typically bind cofactors like FAD, nucleotide binding studies could be relevant for α and β subunits .

  • Functional complementation: Expression of recombinant components in mutant strains lacking the corresponding native protein can demonstrate functional complementation if the phenotype is restored. This approach could be particularly valuable for assessing whether a recombinant atpF can restore ATPase function in an appropriate model system.

  • Membrane potential measurements: Since the F1F0 ATPase in mycoplasmas primarily functions in maintaining the membrane potential, assessing the impact of recombinant subunits on membrane potential using appropriate fluorescent dyes could provide functional insights.

What are the challenges in expressing and purifying membrane proteins like ATP synthase subunit b from Mycoplasma mycoides subsp. mycoides SC?

Expressing and purifying membrane proteins from Mmm SC presents several specific challenges:

  • Hydrophobicity and solubility issues: Membrane proteins like ATP synthase subunit b contain hydrophobic domains that can cause aggregation during expression and purification. This necessitates the careful selection of detergents or other solubilizing agents to maintain protein solubility without disrupting native structure.

  • Proper membrane insertion: For functional studies, membrane proteins often need to be properly inserted into lipid bilayers or suitable membrane mimetics. This may require reconstitution steps following purification.

  • Maintaining structural integrity: Membrane proteins often require specific lipid environments for structural stability. The removal of proteins from their native membrane environment during purification can lead to conformational changes or loss of function.

  • Codon usage optimization: As previously noted, mycoplasmas use a non-standard genetic code where UGA codes for tryptophan. Expression in heterologous hosts requires mutagenesis of these codons to standard tryptophan codons (TGG) .

  • Verification of oligomeric state: Many membrane proteins, including ATP synthase components, function as part of oligomeric complexes. Verifying the correct oligomeric state of purified proteins is essential for functional studies, as demonstrated by the observation of both monomeric and dimeric forms of GlpO .

How do additional copies of ATP synthase genes influence mycoplasma biology and research approaches?

The presence of additional copies of ATP synthase genes in mycoplasmas has significant implications for both evolutionary biology and experimental research:

  • Evolutionary significance: The retention of extra copies of atpA and atpD (encoding α and β subunits, respectively) in many mycoplasma genomes is surprising in the context of reductive evolution and general gene loss in these organisms . This suggests these additional copies serve important functions.

  • Horizontal gene transfer: Genes annotated as atpA and atpD have been found among genes exchanged between bird mycoplasma species and between ruminant mycoplasma species, indicating their importance in adaptation to different hosts .

  • Functional diversification: The extra copies of these genes are often part of distinct gene clusters that encode F1-like ATPases with structures different from the conventional F1F0 ATPase . These F1-like complexes may have evolved new functions or regulatory properties.

  • Research design implications: When studying ATP synthase components in mycoplasmas, researchers must carefully distinguish between the proteins encoded by the conventional F1F0 ATPase operon and those encoded by the additional gene clusters. This requires precise gene targeting and protein-specific antibodies.

  • Experimental verification requirements: The presence of multiple related genes necessitates careful experimental design to ensure specificity when targeting particular ATP synthase components. For atpF research, this would include verifying that experimental manipulations specifically affect the target gene without unintended effects on related genes.

How might ATP synthase components be utilized in developing vaccines against contagious bovine pleuropneumonia?

ATP synthase components, including subunit b, could potentially contribute to vaccine development strategies:

  • Attenuation strategy: Drawing parallels from research with GlpO, where deletion of the FAD-binding site rendered the protein inactive while preserving its antigenic properties , specific modifications to ATP synthase components could potentially create attenuated strains with preserved immunogenicity.

  • Antigenic potential assessment: Research would need to determine whether ATP synthase components are sufficiently exposed or immunogenic to elicit protective antibodies. If so, purified recombinant subunits could potentially be used in subunit vaccines.

  • Genetic stability considerations: For live attenuated vaccines, the genetic stability of attenuating mutations is crucial. Deletions in essential components of energy metabolism, such as ATPase subunits, might provide stable attenuation if properly designed.

  • Combined approach: Modifications to ATP synthase components could be combined with other attenuating mutations, such as those affecting known virulence factors like GlpO, to create multi-attenuated strains with enhanced safety profiles.

  • Immune response characterization: Before utilizing ATP synthase components in vaccines, researchers would need to characterize the immune response they elicit, including antibody production, T-cell responses, and protection in animal models.

What gene replacement strategies might work for creating ATP synthase mutants in Mycoplasma mycoides subsp. mycoides SC?

Developing gene replacement methods for creating targeted mutations in ATP synthase genes faces several challenges:

  • Limited homologous recombination efficiency: Mmm SC "does not seem to be particularly apt to homologous recombination" , which complicates standard approaches to allelic replacement. This limitation was noted in attempts to replace the wild-type glpO gene with a modified allele.

  • Essential gene considerations: Many ATPase components are likely essential for mycoplasma survival, based on global transposon mutagenesis studies in several mycoplasma species . Creating viable mutants with alterations in these genes would require careful design of partial deletions or conditional mutation approaches.

  • Selection strategy development: Effective selection strategies for identifying successful gene replacements are crucial. These might include antibiotic resistance markers or counterselectable markers positioned to allow selection for double-crossover events.

  • Genetic tool optimization: While some genetic tools have been developed for Mmm SC, including replicative oriC plasmids and transposon-based mutagenesis methods , more powerful methods for allelic replacement specifically tailored to this organism may be needed.

  • Verification approaches: Confirming successful gene replacement requires robust genomic and phenotypic characterization methods, including PCR, sequencing, and functional assays specific to the modified ATP synthase component.

How can structural information about F1F0 ATPase components inform drug development strategies?

Structural information about F1F0 ATPase components could significantly advance antimicrobial drug development:

  • Identification of unique features: Detailed structural analysis of F1F0 ATPase components could reveal features unique to mycoplasma enzymes that distinguish them from host ATPases. For example, the identification of the FAD-binding site in GlpO (Gly12-Gly13-Gly14-Ile15-Ile16-Gly17) provided a specific target for modification .

  • Rational inhibitor design: Understanding the three-dimensional structure of ATPase components, including subunit b, could enable the rational design of small molecules that specifically inhibit the mycoplasma enzyme without affecting the host's ATP synthase.

  • Protein-protein interaction targeting: The F1F0 ATPase functions as a complex of multiple subunits with numerous protein-protein interactions. Structural information about these interfaces could inform the design of peptides or small molecules that disrupt essential interactions within the complex.

  • Exploiting unique F1-like ATPase features: The unique F1-like ATPases found in some mycoplasma species lack certain components typically considered essential in other bacteria, such as the δ-subunit or b-subunit . These structural differences could potentially be exploited for selective targeting.

  • Structure-based screening approaches: High-throughput virtual screening against structural models of mycoplasma ATP synthase components could identify lead compounds for further development as selective inhibitors, potentially leading to new classes of antimicrobials with novel mechanisms of action.

What are the most promising techniques for studying ATP synthase dynamics in mycoplasmas?

Advanced techniques for studying ATP synthase dynamics in mycoplasmas include:

  • Cryo-electron microscopy (cryo-EM): This technique could provide high-resolution structural information about the complete F1F0 ATPase complex in mycoplasmas, potentially revealing unique features not present in better-studied bacterial systems.

  • Single-molecule biophysics: Techniques such as single-molecule FRET (Förster resonance energy transfer) could provide insights into the conformational changes and rotary mechanics of the mycoplasma F1F0 ATPase during its catalytic cycle.

  • In situ structural studies: Newly developed approaches for studying protein structure in situ, such as cellular cryo-electron tomography, could reveal the native arrangement of ATP synthase complexes in the mycoplasma membrane.

  • Mass spectrometry-based proteomics: Cross-linking mass spectrometry could identify specific interactions between ATP synthase subunits in their native context, providing insights into complex assembly and stability.

  • Real-time monitoring of ATPase activity: Development of fluorescent reporters or biosensors for ATP hydrolysis could enable real-time monitoring of ATPase activity in living mycoplasma cells, providing insights into the physiological regulation of this crucial enzyme.

How do the unique F1-like ATPases in mycoplasmas relate to the conventional F1F0 ATPase?

The relationship between unique F1-like ATPases and conventional F1F0 ATPases in mycoplasmas reveals important evolutionary adaptations:

  • Structural modifications: The F1-like ATPases found in some mycoplasma species have adapted to function without certain components typically considered essential, such as the δ-subunit or b-subunit . This represents a significant structural simplification compared to conventional F1F0 ATPases.

  • Functional specialization: Without a peripheral stalk to anchor the (αβ)3 hexamer to the membrane, these F1-like enzymes likely function exclusively as ATPases rather than ATP synthases . This functional specialization may reflect adaptation to specific aspects of the mycoplasma lifestyle.

  • Protein composition variations: Different types of F1-like ATPase gene clusters exist across mycoplasma species, with variations in protein composition and structure . For example, Type 2 clusters feature a β-like protein with an extension of about 30 kDa at the N-terminus, potentially affecting its interactions with other components .

  • Membrane association: Despite lacking conventional peripheral stalk components, these F1-like ATPases appear to maintain membrane association through alternative mechanisms, as evidenced by the detection of ATPase activity in membrane fractions .

  • Evolutionary origin: The relationship between these specialized F1-like ATPases and conventional F1F0 ATPases suggests a fascinating evolutionary history involving gene duplication, horizontal transfer, and functional divergence .

What methodological improvements could advance research on recombinant ATP synthase components from Mycoplasma mycoides subsp. mycoides SC?

Several methodological improvements could significantly advance research on recombinant ATP synthase components:

  • Development of optimized expression systems: Creating expression systems specifically optimized for mycoplasma membrane proteins, potentially including specialized vectors, chaperones, and host strains.

  • Enhanced gene replacement techniques: Developing more efficient methods for homologous recombination in Mmm SC would facilitate the creation of targeted mutations in ATP synthase genes for functional studies.

  • Advanced purification approaches: Implementation of novel detergents, nanodiscs, or other membrane mimetics could improve the purification of functional membrane proteins like ATP synthase subunit b.

  • Improved activity assays: Development of high-sensitivity, high-throughput assays for ATPase activity would facilitate functional characterization of recombinant ATP synthase components and complexes.

  • Synthetic biology approaches: Application of synthetic biology principles to create minimal ATP synthase complexes or hybrid complexes combining components from different sources could provide new insights into the functional requirements and evolutionary flexibility of these crucial enzymes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.