Recombinant Mycoplasma penetrans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
plsY; MYPE4020; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Mycoplasma penetrans (strain HF-2)
Target Names
plsY
Target Protein Sequence
MNIGNLIGIIILFLFIGYFIGNILFGILISKSQGVDIRTLGSGNVGATNVTRNLGRISGA IVMVLDFFKSWFSTFVCLLIYKALRYSIGDESAYANAGVIIYLGGFAAIIGHCFPCFYFY TLFKTKFNFEEAKKYSGGKGVSSAAGFAASISPWMFFICFVLFWSICLISKYVSLASIVT VFLLPIWSLIPHLNYFYMLDVAQANINPIPPFNRPFEIAAIFNYSLNWWYILVTFLLELL TAVLVIYRHKENIVRLIKGEERKAFAKKTNTH
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO4) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of glycerol-3-phosphate acyltransferase (PlsY) in Mycoplasma penetrans?

PlsY is an integral membrane protein that plays a crucial role in bacterial membrane phospholipid biosynthesis. It specifically catalyzes the transfer of acyl groups from acylphosphate to glycerol-3-phosphate, which represents a critical initial step in the formation of phosphatidic acid, the precursor for membrane phospholipids. This reaction is essential for maintaining membrane integrity in M. penetrans, which, like other mycoplasmas, possesses a minimal genome and relies heavily on this pathway for survival in its parasitic lifestyle . The PlsY-mediated pathway is particularly significant in Mycoplasma species, as these organisms have undergone extensive genome reduction during evolution and depend on efficient membrane synthesis mechanisms to maintain cellular function.

How does the structural topology of PlsY relate to its function?

Based on studies of PlsY from bacteria like Streptococcus pneumoniae, the enzyme typically features five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . Three larger cytoplasmic domains contain highly conserved sequence motifs that are critical for catalytic activity. The first motif (Motif 1) contains essential serine and arginine residues necessary for catalysis. The second motif (Motif 2) functions as a phosphate-binding loop and serves as the glycerol-3-phosphate binding site. The third motif (Motif 3) includes conserved histidine and asparagine residues important for activity, along with a structurally critical glutamate . This topology allows the enzyme to properly orient the substrates within the membrane environment for efficient acyl transfer reactions.

What expression systems are most suitable for producing recombinant M. penetrans PlsY?

For recombinant expression of M. penetrans PlsY, E. coli-based systems have been widely employed for membrane proteins, though with specific modifications to accommodate the challenges of expressing integral membrane proteins. Successful expression typically requires:

  • Codon optimization of the M. penetrans plsY gene for E. coli expression

  • Selection of expression vectors with inducible promoters (such as pET series) that allow tight regulation of expression

  • Use of specialized E. coli strains designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3))

  • Growth at lower temperatures (18-25°C) after induction to slow protein production and facilitate proper membrane insertion

  • Addition of membrane-stabilizing agents in the culture medium

Alternative expression systems, including cell-free approaches that incorporate artificial membrane environments, may also be employed when conventional systems yield insufficient protein or when the recombinant protein affects host cell viability.

What purification strategies are most effective for isolating recombinant M. penetrans PlsY?

Purification of recombinant PlsY requires specialized approaches due to its hydrophobic, membrane-embedded nature. A recommended multi-step purification protocol includes:

  • Membrane Isolation: Cell lysis followed by differential centrifugation to isolate membrane fractions containing the expressed PlsY.

  • Detergent Solubilization: Careful selection of detergents (typically mild non-ionic or zwitterionic detergents like DDM, LDAO, or CHAPS) to extract PlsY from membranes while maintaining its native conformation and activity.

  • Affinity Chromatography: Utilizing affinity tags (His6-tag, Strep-tag, or FLAG-tag) engineered at either terminus of the recombinant protein for specific capture.

  • Size Exclusion Chromatography: As a polishing step to separate properly folded protein from aggregates and to exchange into a stabilizing buffer system.

The choice of detergent is particularly critical, as it must effectively solubilize the protein while preserving enzymatic activity. Researchers should conduct detergent screening experiments to identify optimal conditions for their specific construct.

What are the most reliable methods for assessing PlsY enzymatic activity in vitro?

Several complementary approaches can be used to measure PlsY activity:

  • Radiometric Assay: Measuring the incorporation of radiolabeled acyl groups (typically 14C or 3H-labeled) from acylphosphate into glycerol-3-phosphate to form lysophosphatidic acid.

  • Coupled Enzyme Assay: Monitoring the consumption of glycerol-3-phosphate or production of phosphate indirectly through coupled reactions with spectrophotometric readouts.

  • Mass Spectrometry-Based Approach: Directly quantifying the formation of lysophosphatidic acid products using LC-MS/MS techniques.

  • Fluorescence-Based Assays: Utilizing fluorescently labeled substrates or coupling the reaction to fluorogenic detection systems for high-throughput screening applications.

A typical assay buffer system would contain 50 mM Tris-HCl (pH 7.5), 10 mM MgCl2, 100 mM NaCl, appropriate detergent below its critical micelle concentration, and substrate concentrations near the Km values (determined through initial velocity experiments).

How can researchers effectively analyze the membrane topology of recombinant PlsY?

The substituted cysteine accessibility method (SCAM) has proven effective for determining the membrane topology of PlsY proteins . This approach involves:

  • Creating a cysteine-free version of PlsY as a background construct

  • Introducing individual cysteine residues at specific positions throughout the protein sequence

  • Treating intact cells or membrane preparations with membrane-impermeable and membrane-permeable sulfhydryl-reactive reagents

  • Analyzing the accessibility of each introduced cysteine to determine its location relative to the membrane

Complementary approaches include:

  • Proteolytic digestion patterns of the native protein in membrane vesicles

  • Epitope insertion scanning with subsequent antibody accessibility testing

  • Computational topology predictions validated by experimental data

These methods collectively provide a comprehensive map of protein segments that traverse the membrane, face the cytoplasm, or are exposed to the external environment.

How does the catalytic mechanism of M. penetrans PlsY compare with other bacterial acyltransferases?

The catalytic mechanism of PlsY involves several critical steps that distinguish it from other acyltransferases:

  • Substrate Recognition: The acylphosphate substrate (generated by PlsX from acyl-ACP) binds to a positively charged pocket formed by conserved residues, including the essential arginine in Motif 1.

  • Nucleophilic Attack: The hydroxyl group of glycerol-3-phosphate, potentially activated by the conserved serine residue in Motif 1, attacks the carbonyl carbon of the acylphosphate.

  • Transition State Stabilization: The phosphate-binding loop in Motif 2 stabilizes the negatively charged transition state.

  • Product Release: After acyl transfer, the resulting lysophosphatidic acid product is released, likely into the membrane bilayer.

Unlike the mammalian glycerol-3-phosphate acyltransferases (GPATs) that utilize acyl-CoA as acyl donors, bacterial PlsY employs acylphosphate, representing a significant mechanistic and evolutionary divergence. This difference highlights PlsY as a potential antimicrobial target due to its absence in mammalian systems. The catalytic pocket structure, with its three conserved motifs arranged to facilitate substrate binding and catalysis, represents a specialized adaptation for efficient phospholipid synthesis in the bacterial membrane environment .

What is the relationship between PlsY function and phase variation in M. penetrans surface antigens?

M. penetrans exhibits remarkable surface antigenic variation through phase variation of lipid-associated membrane proteins (LAMPs) . While direct experimental evidence linking PlsY function to this process is limited, several potential connections exist:

  • Membrane Composition Influence: PlsY activity directly affects phospholipid composition, which may influence the incorporation and display of phase-variable LAMPs in the membrane.

  • Acylation Patterns: The specificity of PlsY for particular acyl groups could influence the acylation patterns of lipoproteins, potentially affecting their trafficking and membrane association.

  • Regulatory Interactions: In the highly reduced Mycoplasma genome, multi-functional roles for essential enzymes like PlsY could include regulatory influences on gene expression, possibly including the promoter inversion mechanisms that control LAMP expression.

The M. penetrans genome contains at least 38 mpl genes encoding surface lipoproteins that undergo phase variation through promoter inversions . These variations occur with frequencies ranging from 10^-2 to 10^-4 per cell per generation . Understanding the potential interplay between membrane lipid composition (influenced by PlsY) and phase variation could provide insights into M. penetrans pathogenicity and immune evasion strategies.

What structural features distinguish M. penetrans PlsY from homologs in other bacterial species?

While specific structural data for M. penetrans PlsY is limited, comparative analysis with characterized homologs reveals several noteworthy features:

FeatureM. penetrans PlsYOther Bacterial PlsY ProteinsFunctional Significance
Membrane SpansPredicted 5 transmembrane segments5 confirmed in S. pneumoniaeConserved membrane topology essential for function
Cytoplasmic DomainsThree major loops containing conserved motifsSimilar arrangement in characterized homologsPositioning of catalytic residues for substrate access
Motif 1Contains conserved Ser/Arg residuesHighly conserved across speciesEssential for substrate binding and catalysis
Motif 2Phosphate-binding loop structureConserved glycines critical for G3P bindingSubstrate specificity determinant
Motif 3Contains His/Asn/Glu residuesConserved active site componentsCatalytic activity and structural integrity
SizeTypically ~30-35 kDaSimilar size range across speciesReflects conserved core function with species-specific variations

M. penetrans PlsY likely shares the core structural features necessary for acyltransferase activity while potentially possessing unique adaptations related to its minimal genome context and parasitic lifestyle. These adaptations may include differences in substrate specificity, membrane interaction, or regulatory mechanisms compared to homologs from free-living bacteria.

What are common challenges in expressing and purifying recombinant M. penetrans PlsY, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant M. penetrans PlsY:

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage, use specialized expression strains (C41/C43), lower induction temperature (16-20°C), and test different induction conditions (IPTG concentration, induction time).

  • Protein Misfolding and Aggregation:

    • Challenge: Overexpressed membrane proteins commonly aggregate in inclusion bodies.

    • Solution: Employ fusion partners (MBP, SUMO) to enhance solubility, optimize membrane insertion using specialized E. coli strains, and consider cell-free expression systems with supplied lipid environments.

  • Detergent Selection:

    • Challenge: Identifying detergents that effectively extract PlsY while maintaining activity.

    • Solution: Conduct systematic detergent screening using both activity assays and protein stability assessments. Consider natively-sourced lipids from Mycoplasma to stabilize the extracted protein.

  • Protein Instability:

    • Challenge: Purified PlsY may rapidly lose activity during purification and storage.

    • Solution: Include stabilizing agents (glycerol 10-20%, specific lipids), minimize purification time, avoid freeze-thaw cycles, and consider protein engineering to enhance stability.

  • Activity Reconstitution:

    • Challenge: Maintaining enzymatic activity in detergent-solubilized form.

    • Solution: Reconstitute the purified protein into liposomes or nanodiscs composed of lipids that mimic the native Mycoplasma membrane environment.

Systematic optimization of these parameters, potentially using design of experiments (DoE) approaches, can significantly improve recombinant PlsY production and quality.

How can researchers investigate the substrate specificity of M. penetrans PlsY?

Investigating substrate specificity requires a multi-faceted approach:

  • Acyl Chain Preference Analysis:

    • Prepare a panel of acylphosphate substrates with varying chain lengths (C8-C20) and saturation states

    • Conduct comparative kinetic analysis (kcat, Km) for each substrate under standardized conditions

    • Plot relative activity versus acyl chain properties to identify preference patterns

  • Glycerol-3-phosphate Analog Testing:

    • Synthesize modified glycerol-3-phosphate analogs (position isomers, substituted derivatives)

    • Evaluate their effectiveness as substrates or potential inhibitors

    • Determine structure-activity relationships to map the substrate binding pocket

  • Competition Assays:

    • Perform enzyme assays with mixed substrates to identify preferential utilization

    • Calculate competition indices between different acyl donors

    • Correlate findings with the lipid composition observed in native M. penetrans membranes

  • Site-Directed Mutagenesis:

    • Identify and mutate residues in the three conserved motifs that may influence substrate specificity

    • Compare kinetic parameters of wild-type and mutant enzymes with various substrates

    • Use these results to map the substrate binding pocket architecture

The findings can be presented in comparative activity tables showing relative specificity constants (kcat/Km) for different substrates, providing valuable insights into the enzyme's preference in the context of M. penetrans membrane composition.

What controls and validations are essential when studying inhibitors of M. penetrans PlsY activity?

When evaluating potential inhibitors of M. penetrans PlsY, researchers should implement these critical controls and validations:

  • Enzyme Quality Controls:

    • Verify enzyme purity (>90% by SDS-PAGE)

    • Confirm consistent specific activity across preparations

    • Establish stability under assay conditions (time-dependent activity measurements)

  • Assay Validation:

    • Demonstrate linearity with respect to time and enzyme concentration

    • Verify that substrate concentrations are appropriate (typically at or below Km)

    • Include positive controls (known inhibitors like palmitoyl-CoA)

    • Include appropriate vehicle controls for inhibitor solvents (DMSO, ethanol)

  • Inhibition Mechanism Characterization:

    • Perform detailed kinetic analysis to distinguish between competitive, noncompetitive, and uncompetitive mechanisms

    • Generate Lineweaver-Burk and Dixon plots to determine inhibition constants (Ki)

    • Evaluate time-dependent inhibition to identify potential slow-binding or irreversible inhibitors

  • Specificity Controls:

    • Test inhibitors against related enzymes (other acyltransferases) to assess selectivity

    • Evaluate effects on other essential enzymatic activities in M. penetrans

    • Conduct counter-screening against mammalian GPATs to identify selective inhibitors

  • Secondary Validation Approaches:

    • Thermal shift assays to confirm direct binding to the enzyme

    • Surface plasmon resonance or isothermal titration calorimetry to quantify binding affinities

    • Structural studies (if possible) to confirm binding modes

These rigorous controls ensure that identified inhibitors are specifically targeting PlsY through well-characterized mechanisms, providing a solid foundation for further development of antimicrobial agents targeting this essential pathway.

How might recombinant M. penetrans PlsY be utilized in studying host-pathogen interactions?

Recombinant M. penetrans PlsY offers several avenues for investigating host-pathogen interactions:

  • Membrane Composition Manipulation:

    • Using PlsY variants with altered substrate specificity to modify M. penetrans membrane composition

    • Evaluating how these modifications affect host cell recognition, adhesion, and immune responses

    • Correlating membrane lipid profiles with changes in pathogenicity

  • Antibody Generation and Diagnostic Development:

    • Purified recombinant PlsY can serve as an antigen for producing specific antibodies

    • These antibodies could be used to detect M. penetrans in clinical samples

    • Immunolocalization studies could reveal the distribution of PlsY during different stages of infection

  • Immune Response Characterization:

    • Investigating whether PlsY is recognized by the host immune system during natural infection

    • Determining if antibodies against PlsY contribute to protective immunity

    • Exploring potential cross-reactivity with host proteins that might contribute to autoimmune responses

  • Therapeutic Target Validation:

    • Using conditional expression systems to modulate PlsY levels in M. penetrans

    • Assessing the impact on bacterial survival and virulence in cell culture infection models

    • Testing selective inhibitors in ex vivo infection models to validate PlsY as a therapeutic target

Since M. penetrans infections have been associated with HIV and certain immunocompromised conditions , these studies may provide insights into opportunistic infection mechanisms and potential intervention strategies.

What is the relationship between PlsY activity and the phase variation mechanisms in M. penetrans?

The relationship between PlsY activity and phase variation in M. penetrans involves several potential mechanisms:

  • Membrane Environment Influence on DNA Inversion:

    • M. penetrans employs promoter inversions to regulate the expression of surface lipoproteins (P35 family)

    • The phospholipid composition, determined in part by PlsY activity, may influence the DNA binding and activity of invertases or recombinases responsible for these inversions

    • Changes in membrane fluidity or charge distribution could affect DNA-protein interactions necessary for the inversion process

  • Coordinated Regulation:

    • In the reduced Mycoplasma genome, regulatory networks are streamlined and often interconnected

    • PlsY activity may be coordinated with phase variation through shared regulatory elements or metabolic sensors

    • The rate of phase variation (10^-2 to 10^-4 per cell per generation) might be influenced by membrane phospholipid composition

  • Integration of Metabolic State with Surface Variation:

    • PlsY function directly reflects the availability of fatty acid precursors, linking environmental nutrient availability to membrane composition

    • This metabolic information could be integrated with decisions about surface antigen expression to optimize survival under changing conditions

    • The 38 mpl genes identified in M. penetrans may show differential regulation based on membrane phospholipid status

While direct experimental evidence linking these processes is limited, understanding this potential relationship could provide insights into how M. penetrans coordinates its metabolic state with its surface properties during host interaction and immune evasion.

What computational approaches can aid in studying M. penetrans PlsY structure-function relationships?

Several computational approaches can advance our understanding of M. penetrans PlsY:

These computational approaches, when integrated with experimental data, provide a powerful framework for understanding PlsY structure-function relationships and guiding experimental design for further characterization and inhibitor development.

What are the most promising research directions for studying M. penetrans PlsY in the context of bacterial pathogenesis?

Several high-potential research avenues for M. penetrans PlsY include:

  • Structure-Based Drug Design:

    • Determining the high-resolution structure of M. penetrans PlsY through X-ray crystallography or cryo-electron microscopy

    • Using structural insights to design selective inhibitors targeting the unique features of the enzyme

    • Developing non-substrate mimetic inhibitors that could overcome potential resistance mechanisms

  • Systems-Level Integration:

    • Investigating how PlsY activity coordinates with other aspects of M. penetrans metabolism

    • Exploring potential regulatory connections between phospholipid biosynthesis and virulence factor expression

    • Mapping interaction networks to identify proteins that physically or functionally interact with PlsY

  • Host-Pathogen Interface Studies:

    • Determining whether PlsY-dependent modifications in membrane composition affect recognition by host immune components

    • Investigating if PlsY activity changes during different stages of infection or in response to host factors

    • Exploring potential molecular mimicry between bacterial phospholipids and host membrane components

  • Comparative Analysis Across Mycoplasma Species:

    • Analyzing functional differences in PlsY enzymes from various Mycoplasma species with different host specificities

    • Correlating PlsY properties with pathogenicity patterns across the genus

    • Identifying species-specific features that might contribute to tissue tropism or virulence

These research directions could significantly advance our understanding of M. penetrans pathogenesis and potentially lead to novel therapeutic approaches targeting this challenging pathogen.

How might advances in structural biology techniques contribute to our understanding of M. penetrans PlsY?

Emerging structural biology techniques offer unprecedented opportunities for studying membrane proteins like PlsY:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle cryo-EM can now resolve membrane protein structures to near-atomic resolution

    • This approach requires less protein than crystallography and can capture multiple conformational states

    • Application to PlsY could reveal substrate binding mechanisms and conformational changes during catalysis

  • Integrative Structural Biology:

    • Combining multiple experimental approaches (X-ray crystallography, NMR, SAXS, crosslinking-mass spectrometry)

    • Creating comprehensive structural models that incorporate dynamic information

    • Revealing both stable structural elements and flexible regions important for function

  • Time-Resolved Structural Methods:

    • X-ray free-electron laser (XFEL) technology for capturing transient catalytic intermediates

    • Time-resolved cryo-EM to visualize conformational changes during the catalytic cycle

    • Correlating structural snapshots with kinetic data to develop complete mechanistic models

  • Native Mass Spectrometry:

    • Characterizing the oligomeric state and lipid interactions of PlsY in native-like conditions

    • Identifying specific lipids that co-purify with the enzyme and may be important for function

    • Detecting conformational changes in response to substrate binding or inhibitor interaction

These advanced approaches could provide unprecedented insights into the structure-function relationships of this essential membrane enzyme, potentially revealing novel features that could be exploited for therapeutic development.

What interdisciplinary approaches might accelerate research on M. penetrans PlsY and related acyltransferases?

Interdisciplinary collaborations offer powerful strategies to advance PlsY research:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.