Recombinant Mycoplasma penetrans Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

LspA processes prolipoproteins by cleaving the N-terminal signal peptide, enabling lipid anchoring to bacterial membranes. This step is vital for:

  • Virulence: Mature lipoproteins activate host immune responses via Toll-like receptors (TLRs) .

  • Pathogen Survival: Proper lipoprotein localization supports bacterial adhesion and evasion of host defenses .

Key Functional Assays:

Assay TypeMethodologyFindingsSource
Globomycin ResistanceOverexpression in E. coliConfers resistance by enhancing prolipoprotein processing
TLR ActivationNF-κB reporter assays in THP-1 cellsM. penetrans lipoproteins activate TLR1/2, dependent on LspA processing

Role in Immune Activation

  • TLR1/2 Activation: Processed lipoproteins from M. penetrans trigger NF-κB via TLR1/2, enhancing HIV long-terminal repeat (LTR) activation in monocytes .

  • Vaccine Development: LspA-processed lipoproteins are antigenic targets, though lipid moieties may exacerbate inflammation, complicating vaccine design .

Comparative Analysis with Other SPase II Enzymes

FeatureM. penetrans LspAE. coli LspARickettsia typhi LspA
Sequence Identity100% (native)22%22%
Globomycin ResistanceYesYesYes
TLR SpecificityTLR1/2N/AN/A

Data compiled from .

Diagnostic and Therapeutic Relevance

  • ELISA Kits: Recombinant LspA is used in serological assays to detect M. penetrans infections .

  • Antibiotic Targeting: SPase II inhibitors like globomycin are explored for mycoplasma-specific therapies .

Challenges and Future Directions

  • Phase Variation: M. penetrans lipoproteins (e.g., P35) undergo antigenic variation, complicating antibody-based detection .

  • Structural Studies: High-resolution structures of LspA could inform rational drug design.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; MYPE1320; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Mycoplasma penetrans (strain HF-2)
Target Names
lspA
Target Protein Sequence
MIKQFFSNVYEGIKHYSNYLWELSKKQLIKIYLNKKHLIWKISIILICAFIVLLTSFLTR NSILNATQSYWELIPGFLVINITGNTGVSFGTLGDSNPSLVYFVQSIPIVLGFFVLLFSS NYLLDIGVSLVFFGGLSNIIDRSIVDNYKYLSGISTNNAVVDYFQFPFIKNSAIFNFPDT FVIIGMIFVGIQIIISFVKDYKKEKDSEENKKPIKDVVLDEERNKTKKEPIKKPIVIQKS
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of Mycoplasma penetrans lipoproteins?

Mycoplasma penetrans is a prokaryotic microorganism with a distinctive elongated flask-like shape and a tip-like structure that facilitates cell invasion both in vitro and in vivo. The organism's adhesion to host cells depends significantly on lipid-associated membrane proteins (LAMPs), particularly the P35 lipoprotein exposed on the mycoplasmal surface . Unlike adhesins in other Mycoplasma species that cluster at tip organelles, P35 is distributed uniformly across the plasma membrane, suggesting a unique mechanism for host-cell interaction . This distribution pattern contrasts with proteins like P1, P30, P90, and HMW3 of M. pneumoniae and M. genitalium protein of adhesion (MgPa) . The P35 lipoprotein serves as both an adhesion molecule and an immunodominant antigen, making it crucial for M. penetrans pathogenicity and host immune response .

What is the relationship between P35 lipoprotein and potential lspA processing in M. penetrans?

The P35 lipoprotein of M. penetrans is a key surface-exposed protein that mediates adhesion to host cells and serves as an immunodominant antigen . As a lipoprotein, P35 likely undergoes post-translational modification and processing by the bacterial lipoprotein maturation pathway, which typically involves signal peptidase II (lspA). While the search results don't specifically describe the processing of P35 by M. penetrans lspA, research in related organisms indicates that lipoproteins require processing by lspA to achieve their mature, functional form . The P35 lipoprotein is acylated, a characteristic modification of bacterial lipoproteins that occurs during maturation . Additionally, gene expression patterns in other bacteria show coordinated regulation of lspA with other lipoprotein processing genes, suggesting integrated functional roles in producing mature surface lipoproteins like P35 .

What are the validated methods for recombinant expression of M. penetrans proteins?

For recombinant expression of M. penetrans proteins such as P35 lipoprotein, the following methodology has been validated: The DNA sequence encoding the target protein (e.g., P35 lipoprotein, protein ID: AAC16392.1) should first be codon-optimized for expression in the selected host system. The optimized sequence can then be inserted into an appropriate expression vector, such as pET-30a(+), which allows for the addition of a hexahistidine tag for purification purposes .

The expression can be performed in Escherichia coli RosettaTM2 (DE3) cells, which are designed to enhance the expression of proteins that contain codons rarely used in E. coli. Protein expression is typically induced using Isopropyl β-D-1-thiogalactopyranoside (IPTG) at a concentration of 0.5 mM . After induction, the bacterial culture is centrifuged (10,000 rpm for 15 minutes), and the pellet is resuspended in PBS containing protease inhibitors (e.g., 0.1 mM PMSF). Cell lysis can be performed by sonication until the solution becomes clear .

Following lysis, the solution is centrifuged at 12,000 rpm for 15 minutes to separate soluble and insoluble fractions. For purification, Ni-NTA immunoaffinity chromatography can be used, with the supernatant loaded onto the column and incubated for 6 hours with gentle agitation at low temperature. The recombinant protein can be eluted using a linear gradient of imidazole (20-150 mM) . The purified protein can be concentrated using ultrafiltration with a regenerated cellulose membrane with an appropriate molecular weight cutoff (e.g., 10 kDa for P35) .

How can researchers effectively identify receptor-ligand interactions for M. penetrans lipoproteins?

Researchers can employ multiple complementary techniques to identify and validate receptor-ligand interactions for M. penetrans lipoproteins:

  • Modified Virus Overlay Protein Binding Assay (VOPBA): This technique can be used to identify potential host cell proteins that interact with bacterial lipoproteins like P35. The assay involves separating membrane protein extracts from host cells (e.g., SV-HUC-1 human uroepithelial cells) by gel electrophoresis, transferring them to a membrane, and then probing with the purified recombinant lipoprotein of interest .

  • Mass Spectrometry Analysis: Potential interacting proteins identified by VOPBA can be analyzed using HPLC-MS to definitively identify the host cell proteins .

  • Recombinant Protein Binding Assays: Direct binding between purified recombinant lipoprotein and candidate receptor proteins can be assessed using techniques such as ELISA or Far-Western blot analysis .

  • siRNA-Mediated Knockdown: To validate the functional relevance of identified receptor proteins, siRNA can be used to reduce expression of the candidate receptor in host cells, followed by adhesion assays to determine if adhesion of the recombinant lipoprotein or intact bacteria is reduced .

  • Inhibition Experiments: Antibodies against the lipoprotein or soluble recombinant receptor proteins can be used to block interaction and assess functional consequences .

  • Localization Studies: Immunofluorescence microscopy can confirm co-localization of the bacterial lipoprotein and host receptor protein .

Using this multi-technique approach, researchers identified γ-actin (ACTG1) as a receptor for M. penetrans P35 lipoprotein, demonstrating that this methodological framework is effective for characterizing lipoprotein-receptor interactions .

What experimental approaches can be used to assess lspA functionality in M. penetrans?

Based on methodologies used for other bacterial species, the functionality of lspA in M. penetrans could be assessed through several experimental approaches:

  • Globomycin Resistance Assay: Overexpression of functional lspA confers increased resistance to globomycin, a specific inhibitor of type II signal peptidase. This approach can be implemented by cloning the M. penetrans lspA gene into an expression vector like pMW119 under an inducible promoter and transforming it into E. coli . The growth of transformed bacteria can be measured in the presence of increasing concentrations of globomycin (ranging from 12.5 to 200 μg/ml) and compared to control strains carrying empty vector .

  • Genetic Complementation: Temperature-sensitive E. coli mutants defective in lspA function (such as strain Y815) can be used in complementation studies. The M. penetrans lspA gene would be introduced into these mutants, and growth restoration at non-permissive temperatures would indicate functional activity of the M. penetrans lspA .

  • Real-time Quantitative RT-PCR: Expression patterns of lspA during different growth phases can be analyzed to understand its role in bacterial physiology. This approach should include comparative analysis with other genes involved in protein secretion pathways, such as lgt (encoding prolipoprotein transferase) and lepB (encoding type I signal peptidase) .

  • Lipoprotein Processing Analysis: Processing of known lipoproteins (like P35) in the presence and absence of lspA inhibition could be assessed by protein immunoblotting, examining shifts in molecular weight that correspond to signal peptide retention .

These methodologies, adapted from work with R. typhi lspA, provide a framework for functional characterization of M. penetrans lspA and its role in lipoprotein processing.

How does phase variation affect expression and function of M. penetrans surface lipoproteins?

M. penetrans demonstrates the ability to modulate its major surface antigen, P35, through phase variation, which represents an important virulence mechanism . While phase variation is not unique among Mollicutes, the specific mechanism employed by M. penetrans appears to differ from those previously characterized in other Mycoplasma species .

Phase variation allows M. penetrans to alter its surface antigenic properties, potentially as a means to evade host immune responses. This property is particularly significant since P35 is the earliest and most prominent antigen recognized by the host immune system in infected patients and experimentally infected animals . The variability in surface antigen expression could explain some of the complexities in host-pathogen interactions and challenges in developing consistent diagnostic approaches for M. penetrans infections.

Researchers investigating this phenomenon should design experiments that can capture the dynamics of P35, including:

  • Sequential isolation and characterization of M. penetrans from experimental infections to track changes in P35 expression

  • Analysis of gene regulation mechanisms that control phase variation

  • Investigation of environmental triggers that may induce phase variation

  • Assessment of how phase variation affects host cell adhesion and immune recognition

Understanding the mechanisms and consequences of phase variation is crucial for developing effective diagnostic tools and potential therapeutic strategies targeting M. penetrans infections.

What are the functional domains of P35 lipoprotein involved in host cell adhesion, and how might they be processed by lspA?

Research has identified specific functional domains within the P35 lipoprotein that are critical for host cell adhesion. Through detailed binding studies, researchers have determined that amino acid residues 35-42 and 179-186 of P35 represent functional domains responsible for binding to the host cell receptor ACTG1 . These regions serve as potential targets for therapeutic interventions against M. penetrans infections .

The processing of P35 by lspA would likely occur at the N-terminal signal sequence, which is characteristic of bacterial lipoproteins. While specific details of M. penetrans P35 processing by lspA are not explicitly described in the search results, the typical mechanism in bacteria involves:

  • Initial modification of the pre-prolipoprotein by diacylglyceryl transferase (lgt) at a conserved cysteine residue

  • Cleavage of the signal peptide by lspA at the modified cysteine

  • Further modification to yield the mature lipoprotein

This processing is essential for proper localization and function of lipoproteins. The identified binding domains (35-42 and 179-186) are likely present in the mature form of P35 after lspA processing and are crucial for its adhesion function. Researchers investigating this relationship could design experiments using globomycin (an lspA inhibitor) to determine how inhibition of lspA affects P35 maturation, localization, and adhesion properties.

How does the expression of lspA and associated processing genes change during different phases of M. penetrans infection?

While the search results don't specifically describe expression patterns of lspA in M. penetrans, studies of related genes in Rickettsia typhi provide a framework for understanding potential expression dynamics. In R. typhi, real-time quantitative RT-PCR analysis revealed differential expression of lspA and related protein processing genes (lgt and lepB) during various stages of intracellular growth .

A similar pattern might be expected in M. penetrans, with key observations potentially including:

  • Preinfection Phase: Based on the R. typhi model, higher expression levels of lspA and related genes might be expected prior to infection, suggesting that metabolically active bacteria with functional protein processing machinery are required for successful host cell invasion .

  • Early Infection Phase: A temporary decrease in expression might occur as the bacteria adapt to the intracellular environment .

  • Exponential Growth Phase: Expression levels likely increase after the bacterial doubling time, supporting the production of new surface proteins needed for bacterial replication and spread .

  • Late Infection/Lytic Phase: Expression may decrease as host cells begin to lyse .

Notably, in R. typhi, the expression patterns of lspA and lgt (both involved in lipoprotein processing) were similar throughout infection, while lepB (involved in general protein secretion) showed consistently higher expression levels . This suggests that while lipoprotein processing is important, general protein secretion may be the predominant activity. Researchers studying M. penetrans should design time-course experiments to track expression of these genes throughout the infection cycle to understand their coordinated regulation and role in pathogenesis.

What are the common challenges in expressing recombinant M. penetrans lipoproteins, and how can they be addressed?

Expressing recombinant M. penetrans lipoproteins presents several technical challenges that researchers should anticipate:

  • Codon Usage Bias: Mycoplasma species have different codon usage patterns compared to common expression hosts like E. coli. Solution: Codon optimization of the target gene sequence is recommended, as implemented for P35 lipoprotein expression . Alternatively, specialized E. coli strains like Rosetta™2(DE3) that supply rare tRNAs can be used .

  • Protein Solubility Issues: Membrane-associated lipoproteins often have hydrophobic regions that can cause aggregation and inclusion body formation during heterologous expression. Solution: Optimize expression conditions by testing different temperatures, induction times, and IPTG concentrations. For P35, successful expression was achieved with 0.5 mM IPTG . Additionally, the solubility and insolubility of the expressed protein should be assessed by analyzing both supernatant and pellet fractions after cell lysis .

  • Preservation of Functional Epitopes: Ensuring that recombinant lipoproteins maintain functional binding domains is crucial. Solution: Careful design of constructs to preserve key regions, such as the identified binding domains of P35 (amino acid residues 35-42 and 179-186) . Functional validation through binding assays with potential receptors is essential.

  • Purification Challenges: Purification of membrane-associated proteins can be difficult. Solution: The use of affinity tags, such as the hexahistidine tag used for rP35, facilitates purification through immobilized metal affinity chromatography (Ni-NTA) . A linear imidazole gradient (20-150 mM) can be employed for elution to optimize purity .

  • Lipid Modifications: Native bacterial lipoproteins undergo post-translational lipid modifications that may not occur correctly in heterologous expression systems. Solution: Consider co-expression with appropriate modification enzymes or focus on the protein portion without lipid modifications if the experimental goals permit.

By anticipating these challenges and implementing the recommended solutions, researchers can improve the likelihood of successfully expressing functional recombinant M. penetrans lipoproteins.

How can researchers distinguish between true receptor-ligand interactions and non-specific binding when studying M. penetrans lipoproteins?

Distinguishing specific receptor-ligand interactions from non-specific binding is critical for accurate characterization of M. penetrans lipoprotein functions. Researchers should implement the following validation approaches:

  • Multiple Binding Assay Techniques: Employ several complementary methods to confirm interactions. The study identifying ACTG1 as a receptor for P35 used modified VOPBA, recombinant protein binding assays, ELISA, Far-Western blot, and inhibition experiments to build a convincing case for specific interaction .

  • Negative Controls: Include appropriate negative controls in all binding assays, such as unrelated proteins of similar size and charge characteristics, or irrelevant cell types that do not express the putative receptor.

  • Competitive Inhibition Assays: Demonstrate that unlabeled ligand can compete with labeled ligand for binding sites in a concentration-dependent manner, indicating specificity of the interaction.

  • Receptor Knockdown/Knockout: Reduce expression of the candidate receptor through siRNA or CRISPR-Cas9 approaches and demonstrate corresponding reduction in binding. In the P35-ACTG1 interaction study, SV-HUC-1 cells transfected with ACTG1-siRNA showed significantly reduced adhesion of both P35 and intact M. penetrans .

  • Domain Mapping: Identify specific binding domains through truncation or mutation analysis. For P35, amino acid residues 35-42 and 179-186 were identified as critical for ACTG1 binding . Mutations in these regions should reduce binding if the interaction is specific.

  • Functional Consequences: Demonstrate that the interaction has biological relevance by showing functional outcomes. For example, blocking the P35-ACTG1 interaction reduced M. penetrans adhesion to host cells .

  • Binding Kinetics and Affinity Measurements: Quantitative binding studies using techniques like surface plasmon resonance can differentiate high-affinity specific interactions from low-affinity non-specific binding.

The research on P35-ACTG1 interaction noted inconsistencies in binding of certain P35 fragments (specifically P35-1) to ACTG1 in Far-Western blot, suggesting possible low-affinity interactions . To resolve such inconsistencies, additional experiments like X-ray crystallography or the construction of binding domain mutants were recommended .

What considerations are important when designing inhibitors targeting lspA or lipoprotein-receptor interactions in M. penetrans?

When designing inhibitors targeting either lspA or lipoprotein-receptor interactions in M. penetrans, researchers should consider several important factors:

For lspA inhibitors:

  • Specificity: Design inhibitors that selectively target bacterial lspA without affecting host cell proteases. Globomycin is a natural product that specifically inhibits bacterial type II signal peptidases and can serve as a starting point for inhibitor design .

  • Essentiality Assessment: Determine whether lspA is essential for M. penetrans viability or virulence. In many bacteria, lspA is critical for intracellular growth and virulence , making it a potentially valuable target.

  • Structural Considerations: Although specific structural information for M. penetrans lspA is not provided in the search results, inhibitor design should account for conserved catalytic residues and domains essential for SPase II activity .

  • Delivery Systems: Consider how inhibitors will access the target enzyme, which may be membrane-associated. Lipophilic compounds or those conjugated to cell-penetrating peptides may have advantages.

For inhibitors targeting lipoprotein-receptor interactions:

  • Binding Domain Specificity: Target the identified functional domains of P35 lipoprotein (amino acid residues 35-42 and 179-186) that interact with host cell ACTG1 . Peptide mimetics or small molecules designed to compete with these specific regions may disrupt adhesion.

  • Host Cell Receptor Considerations: ACTG1 (γ-actin) is an essential cellular protein with numerous functions. Inhibitors should be designed to block bacterial interactions without disrupting normal host cell functions.

  • Accessibility: Surface-exposed portions of P35 lipoprotein represent more accessible targets than the processing enzyme lspA. The uniform distribution of P35 across the M. penetrans membrane (rather than concentration at a tip structure) may influence inhibitor design strategies .

  • Resistance Potential: Consider the impact of phase variation in P35 expression on long-term inhibitor effectiveness. Targeting conserved regions less subject to variation may provide more durable inhibition.

  • Validation Approaches: Test candidate inhibitors using the established adhesion assays demonstrated in the P35-ACTG1 research, including cell-based adhesion assays with both recombinant P35 and intact M. penetrans .

What are the most promising approaches for developing selective inhibitors against M. penetrans lspA?

Developing selective inhibitors against M. penetrans lspA represents an attractive therapeutic strategy, as protein processing enzymes are often essential for bacterial viability and virulence. Several promising approaches warrant investigation:

  • Structure-Based Drug Design: Although the specific structure of M. penetrans lspA is not described in the search results, researchers could leverage the conserved nature of bacterial signal peptidases to develop homology models. Computational approaches could then be used to identify potential binding pockets and design selective inhibitors.

  • Globomycin Derivatives: Globomycin is a known inhibitor of bacterial type II signal peptidases that has been used experimentally to confirm lspA function . Chemical modification of globomycin scaffolds could yield derivatives with enhanced selectivity, improved pharmacokinetic properties, and reduced toxicity.

  • High-Throughput Screening: Developing functional assays for M. penetrans lspA activity would enable screening of compound libraries to identify novel inhibitor scaffolds. Such assays could be based on the cleavage of fluorogenic peptide substrates mimicking the signal peptide of P35 or other M. penetrans lipoproteins.

  • Peptidomimetic Inhibitors: Design of peptidomimetics based on the known substrates of lspA (such as the signal peptide region of the P35 lipoprotein) could yield competitive inhibitors of the enzyme.

  • Allosteric Inhibitors: Rather than targeting the catalytic site, identifying allosteric sites unique to bacterial lspA could provide opportunities for highly selective inhibition.

  • Validation System Development: Adapting the globomycin resistance and genetic complementation assays demonstrated for R. typhi lspA would provide valuable tools for validating potential M. penetrans lspA inhibitors. Monitoring growth of recombinant E. coli expressing M. penetrans lspA in the presence of candidate inhibitors could serve as an initial screening approach.

  • Combination Approaches: Targeting multiple steps in the lipoprotein processing pathway (e.g., both lgt and lspA) might enhance efficacy and reduce the potential for resistance development.

The development pipeline should include validation of target engagement, assessment of effects on M. penetrans viability and virulence, and evaluation of selectivity against human proteases to minimize potential side effects.

How might understanding the interplay between lspA processing and phase variation of surface lipoproteins advance M. penetrans research?

The interplay between lspA processing and phase variation of surface lipoproteins represents a complex but potentially insightful area for advancing M. penetrans research. Several key research directions emerge from considering this relationship:

  • Regulatory Mechanisms: Investigating whether phase variation of P35 and other surface lipoproteins is linked to changes in expression or activity of processing enzymes like lspA. Time-course experiments measuring both lipoprotein expression and processing enzyme activity could reveal coordinated regulation.

  • Processing Efficiency During Phase Variation: Determining whether lipoproteins undergoing phase variation show altered processing efficiency by lspA. This could involve pulse-chase experiments tracking the maturation of lipoproteins under different phase variation states.

  • Structural Consequences: Exploring how phase variation-induced changes in lipoprotein structure might affect recognition and processing by lspA. Variants of P35 could be expressed recombinantly and their processing by lspA assessed in vitro.

  • Functional Implications: Establishing how the combination of phase variation and lspA processing affects critical functions like adhesion to host cells. The identified binding domains of P35 (amino acid residues 35-42 and 179-186) could be assessed across phase variants to determine functional conservation.

  • Host Immune Evasion: Understanding how phase variation combined with lipoprotein processing contributes to evasion of host immune responses. Since P35 is the earliest and major antigen recognized in infected patients , changes in its processing and presentation could significantly impact immunogenicity.

  • Therapeutic Target Validation: Evaluating whether targeting lspA could circumvent the challenges posed by phase variation by affecting all variants of surface lipoproteins. If lspA processing is essential regardless of phase variation state, it may represent a more stable therapeutic target.

  • Comparative Studies: Examining how the mechanisms of phase variation and lipoprotein processing in M. penetrans compare to those in other mycoplasmas to identify unique features that might contribute to its distinctive pathogenicity.

This integrative research approach could yield fundamental insights into M. penetrans biology while also informing the development of diagnostic tools and therapeutic strategies that account for the dynamic nature of surface antigen expression.

What novel techniques could advance our understanding of M. penetrans lipoprotein processing and receptor interactions?

Several cutting-edge techniques could significantly advance our understanding of M. penetrans lipoprotein processing and receptor interactions:

  • Cryo-Electron Microscopy (Cryo-EM): This technique could provide high-resolution structural information about M. penetrans lipoproteins in their native conformation, potentially revealing how processing by lspA affects their structure and receptor-binding capabilities. Cryo-EM could also visualize lipoprotein-receptor complexes, such as P35-ACTG1, providing insights into binding mechanisms.

  • Single-Molecule Techniques: Methods such as single-molecule FRET (Förster Resonance Energy Transfer) could monitor conformational changes in lipoproteins during processing and receptor binding in real-time, offering dynamic perspectives on these interactions.

  • CRISPR-Cas9 Genome Editing: Development of genetic manipulation systems for M. penetrans using CRISPR technology would allow precise modification of lipoprotein genes and processing enzymes, enabling detailed functional studies. This approach could help resolve inconsistencies observed in binding studies, such as those noted for the P35-1 fragment .

  • Proteomics Approaches:

    • Top-down Proteomics: Analysis of intact lipoproteins could characterize post-translational modifications resulting from lspA processing.

    • Cross-linking Mass Spectrometry: This technique could identify precise contact points between lipoproteins and their receptors, refining our understanding of binding domains beyond the currently identified regions (amino acids 35-42 and 179-186 of P35) .

    • Quantitative Proteomics: Temporal profiling of the M. penetrans proteome during infection could reveal coordination between lipoprotein expression and processing enzyme activity.

  • Advanced Imaging Techniques:

    • Super-Resolution Microscopy: Techniques like STORM or PALM could visualize the distribution and clustering of lipoproteins on the M. penetrans surface with nanometer precision, potentially revealing organization patterns relevant to function.

    • Live-Cell Imaging: Real-time visualization of M. penetrans-host interactions could capture the dynamics of adhesion mediated by lipoproteins like P35.

  • Microfluidics and Organ-on-Chip Models: These systems could provide more physiologically relevant environments for studying lipoprotein-receptor interactions during infection, bridging the gap between in vitro binding studies and in vivo pathogenesis.

  • AlphaFold2 and Other AI-Driven Structural Prediction Tools: These computational approaches could predict structures of M. penetrans lipoproteins and lspA, generating testable hypotheses about processing mechanisms and binding interfaces.

  • Single-Cell RNA-Seq of Infected Host Cells: This approach could reveal how host cells respond to interactions with M. penetrans lipoproteins at the transcriptional level, potentially identifying additional receptors or signaling pathways involved in pathogenesis.

Implementation of these advanced techniques would complement the established methodologies described in the search results, potentially resolving current knowledge gaps and inconsistencies while opening new avenues for therapeutic development.

Table 6.1: Comparison of Key Surface Proteins in Mycoplasma Species

Mycoplasma SpeciesMajor Surface ProteinDistribution PatternPrimary FunctionProcessing Requirement
M. penetransP35 lipoproteinUniform across plasma membraneAdhesion to host cells; immunodominant antigenLikely processed by lspA
M. pneumoniaeP1, P30, P90, HMW3Clustered at tip organellesAdhesion to respiratory epitheliumVarious processing pathways
M. genitaliumMgPaClustered at tip organellesAdhesion to urogenital epitheliumVarious processing pathways
M. hominisP50Distributed throughout cell surfaceAdhesion to host cellsUnknown

Data compiled from search result

Table 6.2: Functional Domains and Binding Properties of M. penetrans P35 Lipoprotein

P35 RegionAmino Acid ResiduesBinding PartnerFunctionExperimental Validation
N-terminal region35-42ACTG1 (γ-actin)Host cell adhesionBinding assays, inhibition experiments
C-terminal region179-186ACTG1 (γ-actin)Host cell adhesionBinding assays, inhibition experiments
P35-1 fragmentNot specifiedACTG1Inconsistent bindingFar-Western blot showing potential low-affinity interaction

Data compiled from search result

Table 6.3: Expression Patterns of Protein Processing Genes During Bacterial Infection Cycle

Infection StagelspA Expressionlgt ExpressionlepB ExpressionBiological Significance
Pre-infectionHighHighHighestMetabolically active bacteria required for infection
Early infection (0-8h)DecreasingDecreasingDecreasing but higher than othersAdaptation to intracellular environment
Mid-infection (8-48h)IncreasingIncreasingIncreasing, consistently higherSupport for bacterial replication
Late infection (120h)DecreasingDecreasingDecreasingHost cell lysis phase

Data adapted from R. typhi study in search result , potential pattern for M. penetrans

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.