Recombinant Mycoplasma penetrans Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mycoplasma penetrans Membrane Protein Insertase YidC (yidC) is a bacterially expressed protein derived from the yidC gene of Mycoplasma penetrans, a pathogenic mycoplasma species associated with urogenital and systemic infections . YidC is a universally conserved membrane insertase critical for the integration, folding, and assembly of membrane proteins in bacteria . In M. penetrans, this protein facilitates the insertion of virulence factors and other membrane proteins, contributing to its pathogenicity . The recombinant form enables biochemical and structural studies to elucidate its role in microbial physiology and pathogenesis.

Domain Architecture

The M. penetrans YidC protein comprises 379 amino acids (UniProt ID: Q8EU91) with five transmembrane (TM) domains and a cytoplasmic helical hairpin between TM2 and TM3 . Key structural features include:

Domain/RegionFunction
Transmembrane domainsAnchor the protein to the lipid bilayer .
Helical hairpin (TM2-3)Interacts with ribosomes and substrates during co-translational insertion .
Hydrophilic grooveFacilitates substrate recognition via salt-bridge interactions (e.g., R72) .

Recombinant Production

Recombinant YidC is expressed in E. coli with an N-terminal His-tag for purification . Specifications include:

ParameterDetails
Host systemE. coli
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in deionized water + 5–50% glycerol

Functional Role in Membrane Protein Biogenesis

YidC operates via two pathways:

  1. Sec-independent insertion: Directly integrates substrates like the Pf3 coat protein into membranes through hydrophobic interactions and salt bridges (e.g., R72-D7/D18) .

  2. SecYEG collaboration: Assists the Sec translocon in folding complex membrane proteins .

Key mechanisms include:

  • Hydrophilic cavity formation: Reduces bilayer thickness, easing substrate insertion .

  • Catalytic activity: Each YidC molecule inserts ~150 substrate proteins in vitro, indicating enzymatic efficiency .

Pathogenesis Studies

M. penetrans YidC is implicated in host cell adhesion and immune evasion, critical for chronic infections . Recombinant YidC aids in:

  • Characterizing interactions with host membranes .

  • Screening inhibitors targeting mycoplasmal membrane biogenesis .

Challenges and Future Directions

  • Mechanistic details: The exact substrate translocation pathway remains unresolved .

  • Therapeutic targeting: YidC’s conservation across pathogens makes it a candidate for broad-spectrum antibiotics .

References

  1. [Frontiers in Molecular Biosciences (2022)]

  2. [eLife (2014)]

  3. [OhioLink ETD (2002)]

  4. [EMBO Journal (2004)]

  5. [Creative BioMart (2025)]

  6. [Frontiers in Cellular and Infection Microbiology (2022)]

  7. [Cusabio Product Documentation (2025)]

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
yidC; MYPE10400; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Mycoplasma penetrans (strain HF-2)
Target Names
yidC
Target Protein Sequence
MKNSYINDNFIVSPLWTQAVDPQKEKKEKVVKILKIILKFTKLFIYAFLFLMGLWGCFQT MVDPTVKTSTTIGSGMEFGFPFGSTGDFRYDLTSGANNEYYAFTSTQWNISDYGPFFGLF VYPGAMLVLSIMYPLRDVWGGLDALLGIFVLLFIIRLITFLISIRSTMQSERMSEIQGKL AEINAKYKDVKKDMAMRQKKQLETQELYKKYNIKPFAMFEQMFVTMPIFLIVYRVVTILR PIKVINLFNIWALSASPLSEITSNLSNGGWVFIFFLLIIVPSQIISQKIPQILAKRRNAN ARALSQKGNDSAKKMRISQTVVMVVLVFVVVQSPASVGLYWFLSSLFTIAQSVIIHHYIV KRKTKGVSLEEKLRELGIK
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Additionally, it aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in Mycoplasma penetrans?

YidC is a membrane protein insertase that plays a critical role in the integration of newly synthesized proteins into cellular membranes. In Mycoplasma penetrans, as in other bacterial species, YidC is essential for proper membrane protein insertion and folding. This protein belongs to the evolutionarily conserved YidC/Oxa1/Alb3 protein family found across bacteria, archaea, and eukaryotic organelles .

The primary function of YidC is to mediate the insertion of membrane proteins either independently or in cooperation with the Sec translocase machinery. It acts as a membrane chaperone that supports protein folding reactions within the membrane bilayer, providing an amphiphilic surface that facilitates the transfer of polar regions of inserted proteins across the hydrophobic membrane environment .

How does YidC structure relate to its function in membrane protein insertion?

YidC functions through an intramembrane cavity that creates a hydrophilic microenvironment within the membrane. This specialized structure allows YidC to interact with hydrophobic parts of substrate proteins while simultaneously shielding hydrophilic regions during the membrane transfer process .

The protein operates by accepting partially membrane-bound proteins that have engaged with the lipid bilayer through hydrophobic interactions and promotes their complete integration into a stable transmembrane configuration. YidC effectively transforms these non-membrane-spanning membrane-bound intermediates into properly folded transmembrane proteins .

Crystal structure analyses suggest that YidC creates a crucial hydrophilic environment that enables polar domains of substrate proteins to traverse the otherwise impermeable lipid bilayer, representing a fundamental mechanism for membrane protein biogenesis .

How does Mycoplasma penetrans YidC compare with YidC homologs in other bacterial species?

While specific comparative data for Mycoplasma penetrans YidC is limited in the search results, we can make some inferences based on what is known about mycoplasma biology. As a member of the Mycoplasma genus with a reduced genome, M. penetrans likely maintains only essential cellular machinery, suggesting that YidC in this organism performs critical functions that couldn't be eliminated during genome reduction .

In E. coli, YidC has been well-characterized as functioning both independently and in association with the SecYEG translocon . Studies have demonstrated that purified E. coli YidC is sufficient for the membrane integration of Sec-independent proteins, as shown with the single-spanning Pf3 coat protein in reconstituted proteoliposomes .

The interaction between YidC and the SecYEG translocon has been observed through cross-linking studies. When cells expressing both components were treated with paraformaldehyde (PFA) in vivo, a 95 kDa cross-link product was detected, confirming their physical association .

What are effective methods for studying YidC-mediated membrane protein insertion in vitro?

Researchers investigating YidC function have successfully employed reconstituted proteoliposome systems to study membrane protein insertion in vitro. This methodology involves:

  • Purification of YidC protein to microgram quantities

  • Preparation of liposomes from purified phospholipids

  • Reconstitution of purified YidC into these liposomes

  • Addition of purified substrate proteins (such as the model Pf3 coat protein)

  • Assessment of membrane insertion efficiency

This approach has proven particularly valuable in demonstrating that YidC alone is sufficient for the integration of Sec-independent membrane proteins. For example, studies with the Pf3 coat protein showed efficient insertion into YidC-containing proteoliposomes in the absence of other cellular components .

For quantitative assessment, researchers can analyze membrane integration by measuring the protection of properly inserted proteins from externally added proteases or through biochemical fractionation techniques.

How can researchers detect and quantify YidC in Mycoplasma species?

While specific methods for M. penetrans YidC detection are not directly addressed in the search results, valuable insights can be drawn from approaches used for other mycoplasma proteins. For example, the development of real-time PCR assays targeting conserved genes has proven successful for detecting mycoplasma species in clinical samples .

A methodological approach for YidC detection might include:

  • Gene-targeted PCR detection: Design of primers and probes targeting conserved regions of the yidC gene, similar to the approach used for M. hominis detection via the yidC gene .

  • Protein expression analysis: Development of specific antibodies against M. penetrans YidC for western blot detection and quantification.

  • Cross-linking studies: Implementation of in vivo cross-linking followed by immunoprecipitation to identify YidC interaction partners, as demonstrated in studies of YidC-SecYEG interactions .

When developing such assays, researchers should consider intraspecies heterogeneity. As observed with the M. hominis yidC gene, careful sequence analysis across multiple strains is essential to identify highly conserved regions suitable for targeting. In the M. hominis study, only seven of 732 nucleotides varied among 31 strains analyzed .

What techniques can be used to study the interaction between YidC and the Sec translocase in Mycoplasma?

To investigate potential interactions between YidC and the Sec translocase in Mycoplasma penetrans, researchers can employ several complementary approaches:

  • In vivo cross-linking: Treatment of cells with cross-linking agents such as paraformaldehyde (PFA) followed by affinity purification and immunoblotting to detect specific interaction products. This approach has successfully revealed YidC-SecYEG interactions in other bacterial systems .

  • Co-expression systems: Development of systems where both YidC and SecYEG components are expressed at near-stoichiometric levels to facilitate detection of interactions. Research has shown that efficient cross-linking between YidC and SecY requires approximately equal amounts of both proteins .

  • Protein purification and reconstitution: Isolation of both YidC and SecYEG components followed by reconstitution into proteoliposomes to study their functional cooperation in membrane protein insertion.

  • Mutational analysis: Introduction of specific mutations in YidC domains to identify regions critical for interaction with the Sec machinery.

The key insight from previous work is that detection of YidC-Sec interactions is highly dependent on expression levels. As shown in one study, a 95 kDa cross-link product between YidC and SecY was clearly detectable in a co-expression system but not when YidC was expressed alone .

How might YidC function contribute to Mycoplasma penetrans virulence?

Mycoplasma penetrans possesses several virulence-associated traits that may depend on properly functioning membrane protein biogenesis systems, including YidC. As a membrane protein insertase, YidC likely plays a crucial role in ensuring correct localization and folding of virulence factors exposed on the cell surface or secreted into the host environment .

M. penetrans exhibits specific virulence characteristics including:

  • Host cell invasiveness: The ability to invade host cells and reside within the cytoplasm, a phenomenon observed both in vivo and in vitro. This invasion process depends on actin polymerization within the host cell and involves the bacterial attachment organelle .

  • Production of cytotoxic molecules: Including hydrogen peroxide (H₂O₂) and cytopathic proteins. Among these is a homolog of the community-acquired respiratory distress syndrome (CARDS) toxin that causes vacuolation of host cells .

  • Capsule production: M. penetrans produces a polysaccharide capsule with strain-dependent thickness that may contribute to immune evasion .

  • Gliding motility: This feature varies between strains and may contribute to tissue colonization .

YidC-mediated membrane protein insertion could be critical for the proper assembly of protein complexes involved in these virulence mechanisms, particularly those associated with the bacterial cell surface and attachment organelles.

How does YidC function differ between clinical isolates of Mycoplasma penetrans?

While the search results don't specifically address YidC differences between M. penetrans isolates, they do highlight significant phenotypic variations between clinical strains that might indirectly relate to membrane protein biogenesis:

CharacteristicClinical Isolates from Immunocompetent MalesHF-2 Strain (from Immunocompromised Patient)
Antibiotic resistanceResistant to azithromycinSensitive to azithromycin
Binding to erythrocytesGreater sialic acid-dependent bindingLesser binding capability
Gliding motilityFaster motilitySlower motility
H₂O₂ productionHigher productionLower production
Capsule thicknessThinner capsulesThicker capsule
InvasivenessVariable (some more, some less than HF-2)Reference level
Cytotoxicity to HeLa cellsSimilar to HF-2Reference level

These phenotypic differences between strains could potentially reflect variations in membrane protein composition, which in turn might be influenced by YidC function or expression levels. Future research could investigate whether these differences correlate with variations in YidC sequence, expression, or activity between strains.

What is the mechanism by which YidC facilitates membrane protein insertion independently of the Sec machinery?

YidC employs a unique mechanism for Sec-independent membrane protein insertion that involves creating a protected environment for protein translocation within the membrane. Based on biochemical and structural studies, this process appears to involve several key steps:

  • Initial substrate recognition: YidC interacts with hydrophobic segments of nascent membrane proteins that have partially engaged with the lipid bilayer.

  • Formation of a hydrophilic microenvironment: YidC provides an amphiphilic surface within the membrane that shields hydrophilic portions of the translocating protein chain from the lipid phase.

  • Promotion of proper folding: YidC acts as a membrane chaperone supporting folding reactions within the membrane, facilitating the transition from a non-membrane-spanning intermediate to a properly inserted transmembrane configuration .

Experimental evidence supports this mechanism. For example, studies with the Pf3 coat protein demonstrated that YidC accelerates membrane insertion even for mutant variants with extended hydrophobic regions that can insert independently (albeit more slowly) into pure lipid bilayers .

Cross-linking experiments have confirmed direct interactions between YidC and the hydrophobic regions of substrate proteins during the insertion process, providing further evidence for its chaperone-like function .

How do researchers distinguish between YidC-dependent and YidC-independent membrane protein insertion pathways?

Distinguishing between YidC-dependent and YidC-independent insertion pathways requires carefully designed experimental approaches:

  • In vitro reconstitution systems: Comparison of membrane protein insertion into proteoliposomes with and without reconstituted YidC. This approach has demonstrated that purified YidC is sufficient for the integration of Sec-independent proteins like the Pf3 coat protein .

  • Substrate engineering: Creation of protein variants with modified hydrophobic regions to test dependency on YidC. For example, a mutant Pf3 coat protein with an extended hydrophobic region was found to insert independently of YidC both in vivo and in vitro, though YidC still accelerated the insertion process .

  • Kinetic analysis: Measurement of insertion rates rather than just endpoint efficiency can reveal YidC's role in accelerating insertion even for proteins capable of spontaneous insertion.

  • Topological analysis: Assessment of final protein orientation and complete translocation of hydrophilic domains can distinguish between partial membrane association and proper insertion.

The key insight from existing research is that YidC's substrate specificity is not absolute. Even proteins that can insert into pure lipid bilayers may benefit from YidC-mediated acceleration of insertion or assistance with proper folding within the membrane environment .

What are the current limitations in studying Mycoplasma penetrans YidC and how might they be overcome?

Research on M. penetrans YidC faces several challenges that require innovative approaches:

  • Mycoplasma cultivation challenges: M. penetrans has historically been difficult to isolate and culture, particularly from immunocompetent individuals. Recent advances in cultivation techniques that enabled isolation from immunocompetent males with nongonococcal urethritis could be applied to generate more diverse strain collections for comparative studies .

  • Limited genetic tools: Development of more robust genetic manipulation systems for mycoplasmas would facilitate functional studies of YidC through gene knockout, knockdown, or modification approaches.

  • Structural characterization: While crystal structures exist for YidC from some bacterial species, obtaining structural information for M. penetrans YidC remains challenging. Cryo-electron microscopy might offer advantages for structural studies of membrane proteins like YidC.

  • Reconstitution of the minimal membrane protein insertion machinery: Determining which components beyond YidC are essential for membrane protein insertion in the minimal genome context of M. penetrans would provide valuable insights.

  • Development of specific detection methods: Creation of M. penetrans YidC-specific antibodies and nucleic acid probes would facilitate studies of expression levels and localization.

These limitations could be addressed through collaborative approaches combining expertise in mycoplasma biology, membrane protein biochemistry, and structural biology techniques.

How might understanding YidC function in Mycoplasma penetrans contribute to novel antimicrobial strategies?

The emergence of M. penetrans as a pathogen in both immunocompromised and immunocompetent individuals highlights the need for new therapeutic approaches. YidC represents a potential target for antimicrobial development for several compelling reasons:

  • Essential cellular function: YidC mediates critical membrane protein insertion processes that are likely essential for mycoplasma viability and virulence.

  • Surface exposure: As a membrane protein, portions of YidC may be accessible to inhibitors that don't need to penetrate deeply into the cell.

  • Distinctive features: Despite evolutionary conservation, bacterial YidC proteins differ sufficiently from their eukaryotic counterparts (Oxa1 in mitochondria and Alb3 in chloroplasts) to potentially allow selective targeting .

  • Virulence connection: The correlation between M. penetrans infection and specific clinical presentations, such as nongonococcal urethritis in immunocompetent men, suggests that targeting factors like YidC that may contribute to virulence could be therapeutically valuable .

Potential research strategies might include:

  • High-throughput screening for small molecule inhibitors of YidC-mediated membrane protein insertion

  • Structure-based drug design targeting the hydrophilic cavity of YidC

  • Development of peptide inhibitors that compete with natural YidC substrates

  • Exploration of combination approaches targeting both YidC and the Sec translocase machinery

What role might YidC play in Mycoplasma penetrans adaptation to different host environments?

M. penetrans demonstrates remarkable adaptability, having been detected in various human tissues including the urogenital tract, respiratory tract, and blood . YidC might play a crucial role in this adaptability through several mechanisms:

  • Modulation of surface protein expression: By controlling the insertion of membrane proteins involved in host-pathogen interactions, YidC could influence tissue tropism and host specificity.

  • Adaptation to immune pressures: The observed differences in capsule thickness between M. penetrans isolates from immunocompromised versus immunocompetent hosts suggest adaptation to different immune environments . YidC may participate in regulating the expression of surface components involved in immune evasion.

  • Antibiotic resistance: The azithromycin resistance observed in clinical isolates from immunocompetent males might involve membrane-associated efflux systems dependent on YidC for proper assembly.

  • Environmental sensing: Membrane proteins involved in detecting environmental cues and triggering appropriate responses likely depend on YidC for proper insertion and function.

Future research could explore how YidC activity or substrate specificity might be regulated in response to changing environmental conditions, potentially contributing to M. penetrans adaptability and persistence in different host niches.

How can emerging structural biology techniques advance our understanding of Mycoplasma penetrans YidC?

Recent advances in structural biology offer promising approaches for elucidating the structure and function of M. penetrans YidC:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology, allowing visualization of proteins in native-like lipid environments without crystallization. Cryo-EM could reveal the structure of M. penetrans YidC alone and in complex with substrate proteins or the Sec translocase.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, NMR spectroscopy, cryo-EM, mass spectrometry) can provide complementary structural information about different aspects of YidC function.

  • Single-molecule approaches: Techniques such as single-molecule FRET (Förster resonance energy transfer) could provide insights into the dynamics of YidC-mediated membrane protein insertion.

  • In situ structural studies: Emerging techniques for studying protein structures directly within cells could reveal how YidC functions in its native membrane environment.

  • AlphaFold and related AI approaches: These computational methods have dramatically improved protein structure prediction and could provide valuable models of M. penetrans YidC structure, especially when combined with limited experimental data.

These approaches could help address key questions about how M. penetrans YidC differs structurally from better-characterized bacterial homologs and how these differences relate to function in the minimal genome context of mycoplasmas.

What novel experimental systems could advance the study of YidC function in Mycoplasma penetrans?

Development of new experimental systems would significantly advance research on M. penetrans YidC:

  • Mycoplasma-specific expression systems: Creation of optimized vectors and host strains for efficient expression of recombinant M. penetrans proteins, including YidC.

  • Cell-free translation-insertion systems: Development of coupled transcription-translation systems supplemented with YidC-containing liposomes could allow high-throughput assessment of YidC substrates and inhibitors.

  • Synthetic minimal cells: Engineering of minimal cells with defined membrane protein insertion machinery could provide insights into the essential components required for YidC function.

  • Microfluidic platforms: These systems could enable single-cell analysis of membrane protein insertion dynamics in real-time.

  • Nanodiscs and other membrane mimetics: These technologies provide stable, defined membrane environments for studying membrane proteins and could be applied to investigate M. penetrans YidC structure and function.

The successful implementation of such systems would overcome many current limitations in studying mycoplasma membrane proteins and could accelerate the discovery of new therapeutic approaches targeting YidC function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.