Recombinant Mycoplasma pneumoniae ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us in advance, and we will prioritize its development.
Synonyms
atpF; MPN_602; MP240; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-207
Protein Length
Full Length of Mature Protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
atpF
Target Protein Sequence
CTENVKEIKSESVINELFPNLWVFLAHLLAFVILLFLLLFLFWKPTQKFLNQRKALLEEQ VNQANSLEQQAQALLQQANQRHENSLVVAKEIVDQANYEALQLKSEIEKKANRQANLMIF QARQEIEKEKRLIQEQSLKESVELAMLAAKELIIKKVDVKADKAFIEEFIRELEAEDDHD
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links

KEGG: mpn:MPN602

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the ATP synthase complex in Mycoplasma pneumoniae?

The ATP synthase complex in Mycoplasma pneumoniae is a multi-subunit enzyme of the F0F1-type that plays a critical role in energy production for this respiratory pathogen. This complex consists of two major portions: F0, which is embedded in the cytoplasmic membrane and forms a proton channel, and F1, which contains the catalytic sites for ATP synthesis or hydrolysis . As a wall-less bacterium belonging to the Mollicutes class, M. pneumoniae has a relatively streamlined ATP synthase complex compared to many other bacteria, yet it maintains the essential components needed for energy metabolism . The complex includes several subunits, including the beta subunit (AtpD) and subunit b (encoded by atpF), each with specific structural and functional roles in the assembly and operation of the ATP synthase machinery . Understanding this complex is particularly important because M. pneumoniae causes atypical pneumonia and other respiratory tract infections (RTIs), especially among school-aged children and young adults, accounting for up to 20% of all community-acquired pneumonia cases .

What is the role of subunit b (atpF) in the ATP synthase complex?

The subunit b of M. pneumoniae ATP synthase, encoded by the atpF gene, serves as a critical structural component that connects the membrane-embedded F0 portion to the catalytic F1 portion of the ATP synthase complex. Unlike its counterparts in many other bacteria, M. pneumoniae's subunit b has been experimentally verified to be a lipoprotein of the murein lipoprotein type similar to Escherichia coli, giving it unique membrane anchoring properties . The protein is anchored to the cytoplasmic membrane through both an N-terminal lipid modification and a transmembrane domain, creating a stable stator that prevents rotation of the F1 sector relative to F0 during ATP synthesis . This dual anchoring mechanism likely contributes to the structural stability of the ATP synthase complex in the absence of a cell wall, which is characteristic of mycoplasmas. The lipoprotein nature of subunit b appears to be distinctive for M. pneumoniae and potentially other mycoplasmas, representing an adaptation that may be related to their minimal cellular structure and parasitic lifestyle .

What structural characteristics distinguish ATP synthase subunits in M. pneumoniae?

The ATP synthase subunits in M. pneumoniae display several unique structural characteristics that differentiate them from their counterparts in other bacteria. Most notably, the subunit b (atpF) contains a lipid modification at its N-terminus, which was experimentally verified through metabolic labeling with [14C]palmitic acid and by interfering with the processing of the prolipoprotein form using globomycin, a specific inhibitor of signal peptidase II . The beta subunit (AtpD), with a calculated molecular weight of 52,486 Da and 475 amino acids, has been shown to be highly antigenic in infected patients but shows no cross-reactivity with serum samples from healthy blood donors, making it valuable for diagnostic applications . Proteome analysis reveals that M. pneumoniae ATP synthase subunits can be identified by mass spectrometry following two-dimensional gel electrophoresis (2D-E), with the beta subunit appearing as one of the prominently detected proteins in immunoblots probed with serum from RTI patients . The particular membrane topology of subunit b, with both lipid anchoring and a transmembrane domain, suggests an evolutionary adaptation specific to Mycoplasma species that compensates for their lack of a cell wall .

How is recombinant M. pneumoniae ATP synthase beta subunit expressed and purified?

The recombinant M. pneumoniae ATP synthase beta subunit (rAtpD) can be successfully expressed and purified through a well-established protocol that yields functional protein for research and diagnostic applications. The process begins with PCR amplification of the atpD gene (mpn598) from M. pneumoniae M129 strain genomic DNA using specific primers designed to facilitate subsequent cloning steps . The amplified gene is then cloned into an expression vector, such as pDEST 17, which typically includes a histidine tag to facilitate purification and detection of the recombinant protein . This construct is transformed into E. coli BL21 (DE3) cells, which are induced to express the recombinant protein under controlled conditions . Following expression, the rAtpD protein is purified through a multi-step process, typically involving affinity column chromatography (utilizing the histidine tag) followed by ion exchange chromatography to achieve high purity . The expression and purification results can be verified by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and western blot analysis using anti-His antibodies or serum samples from M. pneumoniae-infected patients . This methodology yields recombinant AtpD protein that maintains its antigenic properties and can be recognized by antibodies from infected patients but not by serum from healthy donors.

What techniques are used to verify the lipoprotein nature of subunit b?

The lipoprotein nature of M. pneumoniae ATP synthase subunit b can be verified through several complementary experimental techniques that provide conclusive evidence of its lipid modification. The primary method involves metabolic labeling with [14C]palmitic acid, which gets incorporated into lipoproteins during bacterial growth, allowing for direct detection of lipid-modified proteins through radioactive signal measurement . Another crucial technique is the use of the antibiotic globomycin, a specific inhibitor of signal peptidase II, which interferes with the processing of prolipoproteins, resulting in the accumulation of precursor forms that can be detected and analyzed by electrophoretic techniques . DNA sequence analysis of the F0F1-ATPase operon, particularly the atpF gene, provides initial predictions of lipoprotein characteristics based on the presence of signal sequences and modification sites typical of bacterial lipoproteins . Membrane fractionation studies can further confirm the membrane localization of the subunit, while protease accessibility assays help determine the topology of the protein within the membrane . Mass spectrometry can also be employed to identify the precise sites of lipid modification and characterize the nature of the attached lipid moieties, providing molecular-level confirmation of the lipoprotein structure.

How is the antigenic potential of ATP synthase subunits evaluated?

The antigenic potential of M. pneumoniae ATP synthase subunits is evaluated through a systematic approach that combines proteomic identification with immunological characterization. Initially, serologic proteome analysis is performed by separating M. pneumoniae total protein extracts using two-dimensional gel electrophoresis (2D-E) and identifying proteins that react with serum samples from patients with respiratory tract infections (RTIs) but not with samples from healthy blood donors . Candidate antigens, such as AtpD, are then identified by MALDI-TOF mass spectrometry following in-gel tryptic digestion . Once identified, the genes encoding these proteins are cloned, expressed in E. coli, and the recombinant proteins are purified for further antigenic evaluation . The purified recombinant proteins are tested in immunoblots using serum samples from both infected patients and healthy controls to confirm their specific reactivity with patient antibodies . Further quantitative assessment involves developing in-house enzyme-linked immunosorbent assays (ELISAs) for different antibody classes (IgM, IgA, and IgG) and testing the recombinant proteins against panels of serum samples from infected patients and healthy blood donors . Statistical analysis of the ELISA results provides sensitivity, specificity, and receiver operating characteristic (ROC) curve values, allowing for objective evaluation of the antigenic potential and diagnostic utility of the ATP synthase subunits .

How can recombinant ATP synthase subunits be used for diagnostic purposes?

Recombinant ATP synthase subunits from M. pneumoniae can serve as valuable diagnostic antigens in serological assays designed to detect specific antibody responses in patients with respiratory tract infections. The recombinant ATP synthase beta subunit (rAtpD) has been successfully used as an antigen in in-house enzyme-linked immunosorbent assays (ELISAs) for the detection of IgM, IgA, and IgG antibodies against M. pneumoniae . In pediatric patients, rAtpD showed sensitivities of 65%, 57%, and 78% for IgM, IgA, and IgG detection, respectively, with specificities ranging from 91% to 97% . In adult patients, the sensitivities were 67%, 65%, and 61% for IgM, IgA, and IgG, respectively, with comparable specificity values . The development of these recombinant antigen-based assays addresses limitations of traditional diagnostic methods for M. pneumoniae infections, which is particularly important given that this pathogen is innately resistant to beta-lactam antibiotics commonly prescribed as first-line treatment for respiratory infections . The high specificity of recombinant ATP synthase subunits, particularly when used in combination with other antigenic proteins like the P1 adhesin, provides a foundation for developing rapid point-of-care diagnostic assays that can inform timely and appropriate antibiotic selection .

What are the comparative advantages of different ATP synthase subunits for serological assays?

Different ATP synthase subunits from M. pneumoniae offer distinct advantages when used as antigens in serological assays, with their utility varying based on the specific diagnostic context and patient population. The beta subunit (AtpD) demonstrates excellent specificity in ELISA tests, with very low cross-reactivity with serum from healthy donors (3-10% false positives), making it particularly valuable for confirmatory testing where minimizing false positives is critical . When comparing the performance metrics of different antigens in adult patients, rAtpD showed superior sensitivity for IgM (67% vs. 45%), IgA (65% vs. 55%), and IgG (61% vs. 45%) compared to the recombinant C-terminal fragment of the P1 adhesin (rP1-C) . The area under the ROC curve (AUC) values for rAtpD ranged from 0.841 to 0.877 across different immunoglobulin classes, indicating good discriminatory power . In contrast, while the commercial Ani Labsystems ELISA using P1-enriched whole-cell extract showed higher sensitivity for IgM (94% in adults), its specificity was significantly lower (57%), resulting in many false positives . The data from comparative studies suggests that recombinant ATP synthase subunits may be particularly advantageous in scenarios where specificity is prioritized, such as in epidemiological studies or when screening populations with low disease prevalence .

How does the combination of multiple recombinant antigens improve diagnostic accuracy?

The combination of multiple recombinant antigens, particularly ATP synthase beta subunit (rAtpD) and the C-terminal fragment of P1 adhesin (rP1-C), significantly enhances the diagnostic accuracy of serological assays for M. pneumoniae infection. Binary logistic regression analysis demonstrated that this combination maximally discriminated between infected patients (both children and adults) and healthy subjects for the IgM antibody class, performing better than either antigen used individually or the commercial whole-cell extract . In pediatric patients, the rAtpD-rP1-C combination showed improved sensitivity for IgM detection (80%) compared to either rAtpD (65%) or rP1-C (70%) alone, while maintaining high specificity (89%) . Similarly, in adult patients, the combination improved IgM sensitivity to 80% (compared to 67% for rAtpD and 45% for rP1-C) with a specificity of 87% . For IgA and IgG detection, the antigen combination also outperformed individual antigens, with AUC values of 0.842 and 0.925 in children, and 0.841 and 0.891 in adults, respectively . The improved performance of the antigen combination is likely due to the complementary immune responses they elicit, capturing a broader spectrum of the antibody repertoire produced during infection . The data in Table 3 clearly illustrates this synergistic effect, showing how the combination consistently outperforms individual antigens across all antibody classes and patient groups .

What are common challenges in expressing recombinant M. pneumoniae ATP synthase subunits?

Several challenges may arise during the expression of recombinant M. pneumoniae ATP synthase subunits, requiring specific troubleshooting approaches to overcome. One primary challenge is the potential toxicity of membrane proteins to E. coli host cells, which can result in poor growth rates, plasmid instability, or formation of inclusion bodies . Researchers may need to optimize expression conditions, including temperature (often lowered to 16-25°C), induction timing, and inducer concentration to balance protein yield with proper folding . The codon usage bias between M. pneumoniae and E. coli can significantly impact expression efficiency, potentially necessitating codon optimization of the synthetic gene or the use of E. coli strains supplemented with rare tRNAs . For lipoproteins like subunit b (atpF), ensuring proper post-translational modifications in E. coli can be particularly challenging, as the lipid modification machinery may function differently than in M. pneumoniae . Purification of ATP synthase subunits often requires optimization of detergents for solubilization while maintaining protein stability and native conformation . Furthermore, the detection and validation of expressed proteins require careful selection of controls, as demonstrated in the study where irrelevant His-tagged recombinant proteins were included to confirm the specificity of patient serum reactivity with rAtpD and rP1-C .

How can specificity and sensitivity of ATP synthase-based diagnostic assays be improved?

The specificity and sensitivity of ATP synthase-based diagnostic assays for M. pneumoniae can be enhanced through several strategic approaches that address the limitations observed in current testing methods. Combining multiple recombinant antigens, such as ATP synthase beta subunit (rAtpD) and P1 adhesin C-terminal fragment (rP1-C), has been demonstrated to significantly improve diagnostic performance, particularly for IgM detection, with sensitivity increasing from 65-70% for individual antigens to 80% for the combination in children . Optimizing the cutoff values for each antibody class (IgM, IgA, and IgG) based on receiver operating characteristic (ROC) curve analysis can balance sensitivity and specificity according to the intended use of the assay, whether for screening or confirmation . Implementing statistical approaches like binary logistic regression analysis allows for the development of algorithms that combine results from multiple antigens to maximize discrimination between infected and non-infected individuals . Careful selection of the recombinant protein expression system and purification protocol is essential to ensure consistent antigen quality, as improperly folded or degraded proteins can reduce assay performance . Testing assays against diverse patient populations, including both children and adults, is critical, as the research showed variations in antibody responses between these groups, with children showing stronger IgM responses to rP1-C (70% sensitivity) compared to adults (45% sensitivity) .

What factors affect the stability and activity of recombinant ATP synthase subunits?

Multiple factors can influence the stability and activity of recombinant ATP synthase subunits from M. pneumoniae, with implications for both research applications and diagnostic assay development. The storage conditions, including temperature, buffer composition, and presence of stabilizing agents, play crucial roles in maintaining long-term stability, with typical recommendations including storage at -80°C for long-term preservation or at -20°C with glycerol for working stocks . Freeze-thaw cycles can significantly degrade protein quality, necessitating aliquoting of purified proteins to minimize repeated freezing and thawing . For lipoproteins like subunit b (atpF), the preservation of lipid modifications is particularly challenging, potentially requiring specific detergents or lipid environments to maintain native conformation and antigenicity . The buffer composition used during purification and storage must be optimized to maintain protein solubility while preserving antigenic epitopes, with factors such as pH, ionic strength, and the presence of reducing agents all influencing stability . Post-translational modifications, particularly for the lipoprotein subunit b, which undergoes N-terminal lipid modification, can affect both stability and immunoreactivity, with proper processing being critical for maintaining native antigenic properties . Expression host selection can also impact the authenticity of the recombinant protein, as E. coli may not reproduce all the post-translational modifications present in native M. pneumoniae proteins, potentially affecting their stability and immunological properties .

How might structural modifications of ATP synthase subunits enhance their utility?

Strategic structural modifications of recombinant M. pneumoniae ATP synthase subunits could significantly enhance their utility for both research and diagnostic applications. Epitope mapping and subsequent engineering of immunodominant regions could increase the sensitivity of diagnostic assays by concentrating the most antigenic portions of the proteins, similar to the approach taken with the C-terminal fragment of P1 adhesin (rP1-C) . Creating chimeric proteins that combine multiple immunodominant epitopes from different M. pneumoniae antigens into a single recombinant construct could potentially improve diagnostic performance while simplifying production processes . Site-directed mutagenesis to eliminate cross-reactive epitopes while preserving M. pneumoniae-specific regions could enhance specificity, addressing the challenge of false positives that occurs with some commercial assays . For the lipoprotein subunit b (atpF), developing expression systems that accurately reproduce the lipid modifications found in M. pneumoniae would ensure that recombinant proteins better mimic the native antigens encountered during infection . Stability engineering through the introduction of disulfide bonds or removal of protease-sensitive sites could improve the shelf-life and robustness of recombinant proteins for diagnostic kit development . Additionally, the addition of solubility-enhancing tags or fusion partners could improve the expression yield and solubility of membrane-associated ATP synthase subunits that might otherwise be difficult to produce in recombinant systems .

What knowledge gaps remain in our understanding of M. pneumoniae ATP synthase components?

Despite significant advances, several critical knowledge gaps persist in our understanding of M. pneumoniae ATP synthase components that warrant further investigation. The complete three-dimensional structure of the M. pneumoniae ATP synthase complex remains undetermined, limiting our ability to fully comprehend the unique adaptations of this enzyme in wall-less bacteria and its potential as a drug target . The functional significance of the lipoprotein nature of subunit b is not fully elucidated; while the dual anchoring mechanism (lipid modification and transmembrane domain) has been identified, its evolutionary advantage for M. pneumoniae and its impact on ATP synthase operation requires further study . The immunodominant epitopes of ATP synthase subunits have not been precisely mapped, knowledge that would be valuable for optimizing diagnostic antigens and potentially developing epitope-based vaccines . The temporal dynamics of the antibody response to different ATP synthase subunits during M. pneumoniae infection remains poorly characterized, which could inform the optimal timing for diagnostic testing and improve interpretation of serological results . Potential cross-reactivity of antibodies against M. pneumoniae ATP synthase components with those of other bacterial species needs comprehensive assessment to ensure diagnostic specificity . Finally, the regulatory mechanisms controlling ATP synthase expression in M. pneumoniae under different environmental conditions and during infection remain largely unknown, yet understanding these mechanisms could reveal new insights into the pathogen's adaptation to the human host .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.