Recombinant Mycoplasma pneumoniae ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Description

Expression and Production

Recombinant atpE is produced via heterologous expression in E. coli. This approach avoids challenges associated with expressing mycoplasmal proteins in native hosts due to codon usage biases (e.g., UGA encoding tryptophan instead of a stop codon in M. pneumoniae) . Key steps include:

  1. Cloning: The atpE gene is cloned into a plasmid with a promoter compatible with E. coli.

  2. Expression: Induced in E. coli cultures under optimized conditions (e.g., temperature, inducer concentration).

  3. Purification: His-tagged protein is purified using nickel affinity chromatography .

While M. pneumoniae itself can be used as an expression host for tagged proteins (e.g., Strep-tagged HPr kinase ), atpE production relies on E. coli due to established protocols and scalability.

Contextual Relevance in M. pneumoniae Pathogenesis

While atpE itself is not directly implicated in cytadherence or inflammation, ATP synthase plays a broader role in M. pneumoniae survival:

  • Energy Production: ATP synthase generates ATP via proton motive force, essential for bacterial viability .

  • Inflammatory Responses: ATP synthase subunits like ε (atpC) regulate ATP hydrolysis and may influence host immune responses .

Challenges and Future Directions

  • Limited Data: Current research on atpE is restricted to commercial product descriptions . Functional studies (e.g., enzymatic activity assays) are needed.

  • Antigenic Potential: Comparative serological testing with patient sera could assess its utility in diagnostics, analogous to P1 adhesin or AtpD .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpE; MPN_603; MP239; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
atpE
Target Protein Sequence
MEHVNEILATVGRILHETTTANTNVANKSTERLGAYIGAGITMVGGATVGLGQGYIFGKA VEAVARNPEVEKQVFKLIFIGSAISESSSIYSLLIAFILIFVSGA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the F0 channel, the c-ring subunit directly participates in transmembrane translocation. This homomeric c-ring, composed of 10-14 subunits, forms the central stalk rotor element alongside the F1 delta and epsilon subunits.
Database Links

KEGG: mpn:MPN603

Protein Families
ATPase C chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the ATP synthase subunit c (atpE) in Mycoplasma pneumoniae and what is its function?

ATP synthase subunit c, encoded by the atpE gene in M. pneumoniae, is a component of the F0 domain of ATP synthase, forming the membrane-embedded proton channel. This subunit assembles into a ring structure within the membrane that facilitates proton translocation, which is essential for the rotary mechanism that drives ATP synthesis. In bacterial ATP synthases, subunit c contains essential ion-binding sites, notably including the critical Glu54 residue that participates in proton transfer across the membrane . The protein's function is fundamental to energy generation in M. pneumoniae, especially given this organism's limited metabolic capacity as a minimal bacterium.

How does the structure of M. pneumoniae atpE compare to other bacterial ATP synthase c subunits?

The ATP synthase subunit c of M. pneumoniae shares structural similarities with other bacterial c subunits but possesses distinguishing characteristics. This protein typically forms a dodecameric assembly in the membrane, with key amino acids positioned in specific orientations that facilitate proton transfer. While maintaining the conserved ion-binding site (including the essential Glu54), bacterial ATP synthases are sufficiently distinct from each other to respond to specific inhibitors . This structural distinction is evidenced by the fact that inhibitors such as bedaquiline, which targets Mycobacterium ATP synthase subunit C, show different efficacy profiles against ATP synthases from various bacterial species. The amino acid sequences of ATP synthase subunit c exhibit variations across bacterial species, accounting for these functional differences and inhibitor specificities .

What expression systems are most effective for producing recombinant M. pneumoniae atpE?

For recombinant expression of M. pneumoniae atpE, E. coli BL21(DE3) represents an effective expression system, similar to the successful expression of other M. pneumoniae proteins. The gene can be amplified by PCR and cloned into expression vectors such as pDEST17, which incorporate affinity tags (e.g., His-tag) to facilitate subsequent purification . The recombinant protein can then be purified using affinity column chromatography followed by ion exchange chromatography to obtain highly pure protein . Expression conditions typically require optimization of temperature, IPTG concentration, and induction time to maximize protein yield while maintaining proper folding. Quality control of the expressed protein should include SDS-PAGE and western blot analysis to confirm both the purity and immunoreactivity of the recombinant protein .

What are the challenges in purifying functional recombinant atpE protein?

Purification of functional recombinant atpE presents several challenges due to its hydrophobic nature as a membrane protein. The protein's hydrophobicity can lead to aggregation and inclusion body formation during expression. Researchers typically address this by:

  • Optimizing solubilization conditions using appropriate detergents

  • Employing step-wise purification protocols that maintain protein stability

  • Carefully controlling buffer compositions to preserve native-like protein conformation

  • Using affinity chromatography followed by ion exchange chromatography for high purity

Additionally, maintaining the functional conformation of atpE is critical, as the protein normally exists as part of a multimeric complex. Proper refolding procedures may be necessary if the protein is recovered from inclusion bodies. The functional activity of the purified protein can be assessed using ATP synthesis assays with inverted membrane vesicles, where inhibitor sensitivity profiles (IC50 values) can serve as indicators of proper folding and function .

How can researchers develop assays to evaluate inhibitors targeting M. pneumoniae atpE?

Researchers can develop robust assays to evaluate potential inhibitors of M. pneumoniae atpE by utilizing inverted membrane vesicles. This methodology enables assessment of ATP synthesis inhibition under controlled conditions. The procedure involves:

  • Preparation of inverted membrane vesicles derived from M. pneumoniae or recombinant systems expressing the target protein

  • Establishing baseline ATP synthesis rates using known substrates

  • Determining inhibitory effects of test compounds by measuring ATP production in the presence of various inhibitor concentrations

  • Calculating IC50 values to quantify inhibitory potency

As demonstrated in similar research with other bacterial ATP synthases, known ATP synthase inhibitors (DCCD, CCCP, oligomycin) can serve as positive controls, with IC50 values typically ranging from 0.82 ± 0.17 μg/ml to 8.67 ± 1.9 μg/ml . Specificity can be confirmed by testing unrelated antibiotics (e.g., fluoroquinolones, aminoglycosides) as negative controls. The selectivity index (SI) should be determined by comparing bacterial ATP synthase inhibition to effects on mammalian mitochondrial ATP synthesis to assess potential toxicity .

What amino acid residues in M. pneumoniae atpE are critical for inhibitor binding and function?

Critical amino acid residues in ATP synthase subunit c that affect inhibitor binding and function include positions that, when mutated, confer resistance to ATP synthase inhibitors. Based on structural and functional studies of bacterial ATP synthases, several key residues have been identified:

Amino Acid PositionFunctionEffect When MutatedLocation in Structure
Ala17Inhibitor binding siteMutation to Ser (A17S) confers resistanceNear ion-binding site
Gly18Structural integrityMutation to Cys (G18C) affects inhibitor bindingBetween subunits
Ser26Inhibitor interactionMutation to Leu (S26L) prevents inhibitor bindingExposed at internal portion
Phe47Inhibitor interactionMutation to Leu (F47L) reduces inhibitor affinityExposed at external portion
Glu54Essential ion-bindingCritical for proton translocationActive site for proton transfer

These residues are positioned near the essential ion-binding site Glu54, suggesting that inhibitor binding could interfere with this crucial functional site . The mutations affect either direct interaction with inhibitors or alter the conformation of the binding pocket. Understanding these structure-function relationships is vital for rational design of specific inhibitors targeting M. pneumoniae atpE.

How do mutations in the atpE gene contribute to antimicrobial resistance in M. pneumoniae?

Mutations in the atpE gene contribute to antimicrobial resistance through several mechanisms that affect inhibitor binding and ATP synthase function. Research has identified specific base substitutions (e.g., G52T and T139C) that lead to amino acid changes (G18C and F47L respectively) associated with resistance to ATP synthase inhibitors .

The resistance mechanisms include:

  • Structural alterations at the inhibitor binding site that reduce affinity

  • Conformational changes that maintain protein function despite inhibitor presence

  • Modifications that affect the assembly of the c-ring subunit complex

  • Changes that allow continued proton transfer even when inhibitors are bound

As visualized in molecular models, resistant variants show altered exposure of key residues within the dodecameric assembly. For example, the Leu26 mutation (compared to wild-type Ser26) shows greater exposure at the internal portion of the assembly, while Leu47 (compared to Phe47) appears more exposed in the external portion . These structural changes directly impact inhibitor efficacy without compromising the essential function of ATP synthase in energy production.

What is the correlation between atpE structure and inhibitor specificity in targeting M. pneumoniae?

The structure of ATP synthase subunit c exhibits a direct correlation with inhibitor specificity, as evidenced by structure-activity relationship studies. Effective inhibitors demonstrate specific structural requirements for potent activity against bacterial ATP synthases. For instance, in studies with tomatidine and its analogs:

Structural FeatureEffect on Inhibitory ActivityIC50 ValueMIC Value
Intact spiroaminoketal moietyEssential for activityLower IC50Lower MIC
3β-hydroxyl orientationCritical for binding18.5-18.9 μg/ml0.12-0.25 μg/ml
3α-hydroxyl orientationReduced activity85.1 ± 7.0 μg/ml8 μg/ml
Open spiroaminoketalNo inhibitory activity>1,024 μg/ml>128 μg/ml
Glycosylated formActivity abolishedNo inhibitionNo inhibition

This structure-activity correlation demonstrates that simply possessing a similar molecular backbone is insufficient for inhibition; specific structural features are required for effective targeting of ATP synthase subunit c . Additionally, the marked differences in inhibitor responses between bacterial and mitochondrial ATP synthases (selectivity index >10^5) underscore the structural distinctions that can be exploited for selective antimicrobial development .

What techniques can be used to assess the immunogenicity of recombinant M. pneumoniae atpE?

Assessment of recombinant M. pneumoniae atpE immunogenicity requires a multi-faceted approach involving both in vitro and serological techniques:

  • Serologic Proteome Analysis: This technique can identify immunogenic proteins recognized by patient sera. Two-dimensional gel electrophoresis (2D-E) separation of M. pneumoniae proteins followed by immunoblotting with serum samples from infected patients and healthy controls allows detection of proteins that specifically react with patient antibodies .

  • Immunoblot Analysis: Purified recombinant atpE can be analyzed by western blotting using serum samples from M. pneumoniae-infected patients to confirm immunoreactivity. Specificity can be assessed by including serum samples from healthy blood donors as negative controls and irrelevant purified His-tagged recombinant proteins of similar mass as additional controls .

  • Enzyme-Linked Immunosorbent Assay (ELISA): Development of in-house IgM, IgA, and IgG ELISAs using the recombinant protein allows quantitative assessment of antibody responses. Performance metrics should include sensitivity and specificity values determined using well-characterized serum panels from infected patients and healthy controls .

  • Combinatorial Antigen Analysis: Binary logistic regression analysis can evaluate the diagnostic performance of atpE in combination with other M. pneumoniae antigens, potentially improving diagnostic sensitivity while maintaining high specificity .

How can researchers design experiments to determine the role of atpE in M. pneumoniae pathogenesis?

Designing experiments to elucidate atpE's role in M. pneumoniae pathogenesis requires a systematic approach:

  • Gene Knockout or Mutation Studies: Creating atpE mutants through site-directed mutagenesis or CRISPR-Cas systems to assess the impact on bacterial viability, growth, and virulence.

  • Adhesion and Cytotoxicity Assays: Comparing wild-type and atpE-modified M. pneumoniae for ability to adhere to human respiratory epithelial cell lines and induce cytopathic effects.

  • Host Immune Response Analysis: Measuring pro-inflammatory cytokine and chemokine production in response to wild-type versus atpE-modified bacteria to determine if atpE contributes to inflammatory responses.

  • Animal Model Studies: Utilizing appropriate animal models (e.g., guinea pigs or mice) to assess colonization, inflammation, and disease progression with wild-type and atpE-modified strains.

  • Complement Evasion Analysis: Investigating whether atpE, like other surface-exposed proteins such as EF-Tu, plays a role in binding host complement regulators (e.g., Factor H) to evade complement attack .

  • Comparative Analysis with Known Virulence Factors: Assessing atpE's contribution to pathogenesis relative to established virulence factors such as P1 adhesin, P30, and P116 to contextualize its importance in disease progression .

What are the optimal parameters for developing an ELISA-based diagnostic test using recombinant atpE?

Development of an ELISA-based diagnostic test using recombinant atpE requires optimization of multiple parameters:

ParameterOptimal ConditionsConsiderations
Antigen Coating1-10 μg/ml in carbonate buffer pH 9.6Concentration determined by checkerboard titration
Blocking Solution2-5% BSA or milk proteinsMinimize background while preserving specific signal
Sample DilutionSerum typically 1:100-1:400Optimize for signal-to-noise ratio
Secondary AntibodyAnti-human IgM, IgA, and IgGMultiple isotypes improve sensitivity
SubstrateTMB for colorimetric detectionStandardize development time
Cut-off ValueBased on ROC curve analysisBalance sensitivity and specificity

For diagnostic performance, the test should achieve specificity values of 90-97% for IgM, IgA, and IgG detection, ensuring minimal false positives (3-10%) from healthy donor samples . Sensitivity can be optimized by combining atpE with complementary antigens like the C-terminal fragment of P1 adhesin (rP1-C), which has shown improved discrimination between infected patients and healthy subjects, particularly for the IgM class . Quality control measures should include well-characterized positive and negative control sera on each plate to ensure inter-assay consistency.

How can ATP synthesis inhibition assays be standardized for high-throughput screening of potential antimicrobials?

Standardization of ATP synthesis inhibition assays for high-throughput screening requires:

  • Preparation of Consistent Membrane Vesicles:

    • Establish reproducible protocols for preparing inverted membrane vesicles from M. pneumoniae or expression systems

    • Validate vesicle quality through electron microscopy and baseline ATP synthesis activity

    • Prepare large batches and store aliquots under conditions that maintain stability

  • Assay Miniaturization and Automation:

    • Adapt the assay to 96- or 384-well format

    • Optimize reagent volumes and incubation times

    • Implement automated liquid handling for consistent reagent delivery

  • Controls and Standards:

    • Include known ATP synthase inhibitors (DCCD, CCCP, oligomycin) with established IC50 values (0.82-8.67 μg/ml) as positive controls

    • Use non-inhibitory compounds (e.g., fluoroquinolones, aminoglycosides) as negative controls

    • Implement internal standards to normalize plate-to-plate variations

  • Detection Method Optimization:

    • Select sensitive ATP detection methods (luminescence-based assays preferred)

    • Establish signal stability window and linear dynamic range

    • Validate Z-factor >0.5 to ensure assay quality

  • Data Analysis Pipeline:

    • Implement dose-response curve fitting for IC50 determination

    • Include selectivity assessment with mammalian mitochondrial ATP synthesis

    • Develop clear criteria for hit identification and prioritization

This standardized approach enables reliable screening of compound libraries while minimizing false positives and negatives, facilitating the discovery of novel atpE-targeting antimicrobials.

How do researchers interpret ATP synthase inhibition data to distinguish between target-specific and off-target effects?

Proper interpretation of ATP synthase inhibition data requires a systematic approach to distinguish target-specific from off-target effects:

  • Correlation Analysis: Establish correlation between structural features of inhibitor compounds and their IC50 values. For target-specific inhibitors, clear structure-activity relationships should emerge, as demonstrated with tomatidine analogs where specific features like intact spiroaminoketal moiety and 3β-hydroxyl orientation correlated with potency .

  • Resistance Mutation Studies: Analyze inhibition patterns against wild-type and mutant ATP synthases. Target-specific inhibitors show predictable changes in potency against mutants with alterations in binding site residues (e.g., A17S, G18C, S26L, F47L mutations) .

  • Selectivity Profiling: Compare inhibitory activity against:

    • Bacterial ATP synthase (target)

    • Mitochondrial ATP synthesis (off-target)

    • Other bacterial enzymes and processes (off-target)

    Target-specific inhibitors demonstrate high selectivity indices (>10^5 for tomatidine analogs) between bacterial and mitochondrial ATP synthases .

  • Molecular Docking and Modeling: Use computational approaches to predict binding modes and correlate with experimental data. Target-specific inhibition should align with predicted interactions at known binding sites.

  • Cross-Resistance Patterns: Evaluate inhibitor effectiveness against strains resistant to other ATP synthase inhibitors or unrelated antibiotics. Target-specific inhibitors show cross-resistance only with compounds targeting the same binding site.

What are the key considerations when comparing the immunogenicity of atpE with other M. pneumoniae antigens?

When comparing the immunogenicity of atpE with other M. pneumoniae antigens, researchers should consider:

  • Serological Response Profiles: Compare antibody responses (IgM, IgA, IgG) against multiple antigens in well-characterized patient cohorts. For example, studies with recombinant proteins have shown varying seropositivity rates between different M. pneumoniae antigens, with some proteins preferentially recognized by specific antibody classes .

  • Temporal Dynamics of Antibody Response: Evaluate when antibodies against different antigens appear during infection. Some antigens elicit early responses (more useful for acute diagnosis), while others produce sustained antibody levels (better for retrospective diagnosis).

  • Age-Dependent Variation: Consider how immune responses differ between children and adults. For instance, studies with recombinant P1-C showed that 70% of children's serum samples were IgM-positive compared to 45% of adult samples, while atpD demonstrated more consistent detection rates across age groups (50% in children, 67% in adults for IgM) .

  • Diagnostic Performance Metrics: Analyze sensitivity, specificity, positive and negative predictive values for each antigen individually and in combination. The combination of different antigens often provides improved diagnostic performance through complementary recognition patterns .

  • Cross-Reactivity Assessment: Determine potential cross-reactivity with antigens from other microorganisms to evaluate diagnostic specificity, particularly with closely related Mycoplasma species.

AntigenChildren IgM+Adults IgM+Children IgA+Adults IgA+Children IgG+Adults IgG+Specificity
AtpD50%67%50%65%57%61%90-97%
P1-C70%45%50%55%69%45%90-97%

This data illustrates how different antigens demonstrate varying immunoreactivity profiles across patient demographics and antibody classes .

How can researchers address contradictory findings in atpE functional studies across different experimental systems?

Addressing contradictory findings in atpE functional studies requires a methodical approach:

  • Standardize Experimental Conditions: Variations in membrane vesicle preparation, buffer compositions, and assay parameters can significantly impact results. Researchers should:

    • Establish standard protocols for membrane vesicle preparation

    • Use consistent buffer systems and pH conditions

    • Standardize protein concentrations and substrate levels

    • Implement appropriate controls for each experimental run

  • Cross-Validate Using Multiple Methodologies: Employ complementary techniques to verify findings:

    • Combine ATP synthesis measurements with membrane potential assays

    • Correlate biochemical data with structural studies

    • Verify in vitro findings with in vivo or ex vivo systems

  • Consider Species-Specific Differences: ATP synthase properties vary between bacterial species. Researchers should:

    • Acknowledge that findings from one bacterial species may not translate to M. pneumoniae

    • Directly compare ATP synthases from different sources under identical conditions

    • Note that amino acid sequence variations across bacterial species may account for functional differences

  • Account for Technical Limitations: Each experimental system has inherent limitations:

    • Inverted membrane vesicles may not perfectly recapitulate native membrane environments

    • Recombinant proteins may lack post-translational modifications

    • Expression systems may introduce artifacts

  • Perform Meta-Analysis: Systematically review published data to identify patterns in contradictory findings, focusing on methodological differences that could explain discrepancies.

What computational approaches can be used to predict atpE inhibitor binding and design improved antimicrobials?

Advanced computational approaches offer powerful tools for predicting atpE inhibitor interactions and designing improved antimicrobials:

  • Homology Modeling and Molecular Dynamics:

    • Construct accurate models of M. pneumoniae atpE using homology modeling based on existing ATP synthase structures (e.g., PDB entries 3ZO6 and 1WU0)

    • Refine models through molecular dynamics simulations to capture protein flexibility

    • Simulate the dodecameric assembly to understand subunit interactions and binding pocket accessibility

  • Structure-Based Virtual Screening:

    • Identify potential binding pockets, focusing on regions near critical residues (Ala17, Gly18, Ser26, Phe47, Glu54)

    • Conduct virtual screening of compound libraries against these binding sites

    • Rank compounds based on predicted binding energy and interaction patterns

  • Quantitative Structure-Activity Relationship (QSAR) Analysis:

    • Develop predictive models based on existing inhibitor data

    • Identify structural features critical for activity (e.g., intact spiroaminoketal moiety, 3β-hydroxyl orientation)

    • Generate pharmacophore models that capture essential interaction patterns

  • Molecular Docking and Binding Energy Calculations:

    • Perform detailed docking studies of lead compounds to predict binding modes

    • Calculate binding free energies using methods like MM-GBSA or MM-PBSA

    • Analyze specific protein-ligand interactions that contribute to binding affinity

  • Machine Learning Approaches:

    • Train deep learning models on existing inhibitor datasets

    • Implement generative models for de novo design of atpE-targeted compounds

    • Use reinforcement learning to optimize candidate molecules for desired properties

  • Resistance Mutation Prediction:

    • Simulate the effects of potential resistance mutations on inhibitor binding

    • Design inhibitors that maintain activity against predicted resistant variants

    • Develop combination strategies targeting multiple sites to minimize resistance development

These computational approaches can significantly accelerate the development of selective atpE inhibitors by prioritizing the most promising chemical scaffolds for experimental validation.

What are the current gaps in understanding atpE function in M. pneumoniae, and how might these be addressed?

Current gaps in understanding M. pneumoniae atpE function include:

  • Limited Structural Data: The precise three-dimensional structure of M. pneumoniae atpE remains unresolved. Future research should prioritize:

    • Cryo-electron microscopy studies of the complete ATP synthase complex

    • X-ray crystallography of the c-ring assembly

    • NMR studies of subunit c in membrane environments

  • Incomplete Understanding of Regulation: How atpE expression and function are regulated in response to environmental changes is poorly characterized. Researchers should investigate:

    • Transcriptional and translational regulation mechanisms

    • Post-translational modifications affecting function

    • Protein-protein interactions within the ATP synthase complex

  • Unknown Roles Beyond ATP Synthesis: Potential secondary functions of atpE in M. pneumoniae physiology and pathogenesis remain unexplored. Future studies could examine:

    • Possible roles in membrane organization or stability

    • Interactions with host factors during infection

    • Contributions to stress responses or environmental adaptation

  • Limited In Vivo Functional Data: Most functional studies rely on in vitro systems. To address this gap:

    • Develop genetic tools for conditional atpE expression in M. pneumoniae

    • Establish animal models to study atpE function during infection

    • Utilize innovative approaches like fluorescence resonance energy transfer (FRET) to monitor atpE dynamics in living cells

  • Unclear Evolutionary Adaptations: How M. pneumoniae atpE has evolved specialized features compared to other bacteria remains underexplored. Comparative genomics and evolutionary analyses could provide valuable insights into functional specialization.

How can researchers overcome technical challenges in studying membrane proteins like atpE?

Overcoming technical challenges in studying membrane proteins like atpE requires innovative approaches:

  • Improved Expression Systems:

    • Utilize specialized E. coli strains designed for membrane protein expression

    • Explore cell-free protein synthesis systems that provide better control over membrane mimetics

    • Develop Mycoplasma-based expression systems that maintain native membrane environment

  • Advanced Purification Strategies:

    • Implement native nanodiscs or styrene-maleic acid lipid particles (SMALPs) to extract membrane proteins with their lipid environment intact

    • Optimize detergent screening to identify conditions that maintain protein stability and function

    • Develop affinity tag systems specifically designed for membrane protein purification

  • Innovative Structural Biology Approaches:

    • Apply integrative structural biology combining multiple techniques (cryo-EM, X-ray crystallography, NMR, mass spectrometry)

    • Utilize hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Implement single-particle analysis for heterogeneous samples

  • Functional Reconstitution Systems:

    • Develop proteoliposome systems that better mimic the native membrane composition of M. pneumoniae

    • Establish surface-tethered membrane systems for single-molecule studies

    • Create synthetic cell systems to study atpE function in a controlled but biologically relevant context

  • Advanced Imaging Techniques:

    • Apply super-resolution microscopy to visualize atpE distribution and dynamics

    • Implement correlative light and electron microscopy to connect structural and functional data

    • Develop ATP synthase-specific activity probes for real-time monitoring of function

  • Computational Method Integration:

    • Combine experimental data with molecular dynamics simulations to model membrane protein behavior

    • Develop machine learning approaches to predict membrane protein structures from limited experimental data

    • Create integrated computational pipelines specifically for membrane protein analysis

What potential exists for developing atpE-targeted vaccines against M. pneumoniae?

The potential for developing atpE-targeted vaccines against M. pneumoniae warrants careful consideration:

  • Immunogenicity Assessment:

    • Evaluate whether natural M. pneumoniae infection induces significant anti-atpE antibody responses

    • Compare immunogenicity of atpE to established M. pneumoniae immunogens like P1 and P30

    • Assess conservation of atpE sequences across clinical isolates to predict broad protection

  • Vaccine Design Strategies:

    • Recombinant protein approach: Express and purify atpE fragments with optimized immunogenicity

    • Fusion protein approach: Combine atpE with known immunogenic proteins like P1-C, similar to successful approaches with P30 where fusion with P1-C (amino acids 1287-1518) induced protective IgA responses

    • DNA vaccine approach: Deliver atpE-encoding DNA to promote cellular and humoral immunity

    • Epitope-based approach: Identify and deliver specific immunogenic epitopes from atpE

  • Delivery System Development:

    • Evaluate mucosal delivery systems to target respiratory immunity

    • Test adjuvant combinations to enhance immunogenicity while minimizing inflammatory responses

    • Develop particulate delivery systems (liposomes, nanoparticles) to improve antigen presentation

  • Safety Considerations:

    • Assess potential for autoimmune responses due to molecular mimicry with human ATP synthase

    • Evaluate Th17 responses, as excessive Th17 activation has been problematic with other M. pneumoniae vaccine candidates

    • Carefully monitor for enhanced disease upon challenge in animal models

  • Efficacy Evaluation:

    • Determine correlates of protection (antibody titers, cellular responses)

    • Assess protection against colonization and disease in appropriate animal models

    • Evaluate duration of immunity and need for booster doses

How might combination approaches improve diagnostic or therapeutic applications of recombinant atpE research?

Combination approaches offer significant advantages for diagnostic and therapeutic applications of recombinant atpE research:

  • Multi-Antigen Diagnostic Platforms:

    • Combine atpE with complementary antigens like P1, AtpD, and P30 to improve diagnostic sensitivity

    • Develop multiplexed assays that simultaneously detect antibodies against multiple M. pneumoniae proteins

    • Implement binary logistic regression analysis to determine optimal antigen combinations, similar to studies showing improved discrimination using combined rAtpD and rP1-C antigens

  • Multi-Target Therapeutic Strategies:

    • Develop combination therapies targeting both atpE and other essential M. pneumoniae proteins

    • Design dual-action molecules that simultaneously inhibit ATP synthase and other cellular processes

    • Implement antibiotic cycling or rotation strategies to minimize resistance development

  • Theranostic Approaches:

    • Create platforms that combine diagnostic capabilities with therapeutic delivery

    • Develop antibody-drug conjugates targeting atpE for both detection and inhibition

    • Implement targeted nanoparticle systems for simultaneous imaging and drug delivery

  • Multimodal Resistance Prevention:

    • Target different binding sites within ATP synthase simultaneously

    • Combine atpE inhibitors with compounds affecting other aspects of energy metabolism

    • Develop inhibitors that maintain effectiveness against known resistance mutations by targeting multiple residues

  • Integrated Antimicrobial Platforms:

    • Combine atpE-targeted approaches with immune modulation to enhance bacterial clearance

    • Develop drug-antibody combinations for targeted delivery to infected tissues

    • Create smart delivery systems that respond to M. pneumoniae-specific environmental cues

These combination approaches can overcome limitations of single-target strategies, improving both diagnostic accuracy and therapeutic efficacy while minimizing resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.