Recombinant Mycoplasma pneumoniae CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

Shipped with Ice Packs
In Stock

Description

Key Properties of Recombinant pgsA

PropertyDetailsSource
Accession NumberP75520 (UniProt)
Molecular Weight26,050 Da
Expression SystemCell-free (MBS7026114) or E. coli (CSB-CF017878MLW)
Purity≥85% (SDS-PAGE)
SequenceFull-length (227 amino acids; UniProt: NP_109941.1)
Host OrganismMycoplasma pneumoniae (strain M129 or 29342)
Storage-20°C or -80°C; avoid repeated freeze-thaw cycles

The recombinant protein is produced via cell-free systems or E. coli expression, with purification yielding >85% purity. Its sequence includes a hydrophobic region (amino acids 1–227) consistent with transmembrane localization .

Functional Role in M. pneumoniae Metabolism

pgsA is annotated as phosphatidylglycerophosphate synthase (PGP synthase), catalyzing the transfer of a phosphatidyl group from CDP-diacylglycerol to glycerol-3-phosphate, forming phosphatidylglycerophosphate (PGP) . This reaction is pivotal for synthesizing phosphatidylglycerol, a precursor for cardiolipin and other acidic phospholipids critical for bacterial membrane structure and function.

Experimental Use Cases

ApplicationDetailsSource
Biochemical StudiesEnzymatic assays for phosphatidyltransferase activity.
Membrane BiologyAnalysis of phospholipid composition in M. pneumoniae.
Vaccine DevelopmentTargeted disruption of pgsA for attenuation strategies.

Limitations

  • No Direct Enzymatic Data: No published studies confirm pgsA’s kinetic parameters (e.g., K<sub>m</sub>, V<sub>max</sub>) .

  • Recombinant Protein Specificity: Expression systems may alter post-translational modifications critical for activity .

  • Host Range: Primarily studied in M. pneumoniae; functional conservation across Mycoplasma species requires validation .

Sequence Conservation

FeatureDetailsSource
OrthologsConserved in Mycoplasma spp. (e.g., Mycoplasma genitalium) .
VariantsNo documented SNPs or indels in clinical isolates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
pgsA; MPN_253; MP579; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
pgsA
Target Protein Sequence
MRSPFPVPMVPLTIKTWQKKLPNWLTIYRIFIAVPTIIFLGLNHLLGSVASFTVLGNVTI HLQVSLFIGGVLFITAVISDYLDGYWARKWRVVSNFGKLWDPLADKVIINGVLIALVAYG YFHFSFLIVIVLRDLVLDGLRFYAQEKQLIIPANQWGKWKTTWQMIAILMSCFVFSFSLK ETNSANTKIFYWAIVHLPYYLATAFSLVSFGIYAQQIYKTIKVKVKL
Uniprot No.

Target Background

Function

This protein catalyzes the committed step in the synthesis of acidic phospholipids.

Database Links

KEGG: mpn:MPN253

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase in Mycoplasma pneumoniae?

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) belongs to the transferase family, specifically those transferring non-standard substituted phosphate groups. In M. pneumoniae, as in other organisms, this enzyme catalyzes the critical reaction between CDP-diacylglycerol and sn-glycerol 3-phosphate to produce CMP and 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate . This reaction represents a key step in glycerophospholipid metabolism, which is particularly important for membrane formation in M. pneumoniae. Unlike many bacteria, M. pneumoniae lacks a cell wall and relies entirely on its cell membrane for structural integrity and interaction with host cells, making phospholipid biosynthesis enzymes like pgsA particularly significant for its survival and pathogenicity.

What are the current methodologies for isolating and purifying recombinant pgsA from Mycoplasma pneumoniae?

Isolation and purification of recombinant pgsA typically begins with PCR amplification of the pgsA gene from M. pneumoniae genomic DNA, followed by cloning into an appropriate expression vector. Expression systems similar to those used for other M. pneumoniae proteins can be adapted, such as the approach used for P1 and P30 proteins where specific gene segments were inserted into viral vectors . For purification, researchers commonly employ affinity chromatography techniques using histidine or other tags fused to the recombinant protein. The unique properties of M. pneumoniae, including its use of the universal stop codon UGA as a codon for tryptophan , must be considered when designing expression systems in heterologous hosts. Purification protocols often include optimization steps to maintain enzyme activity, such as including appropriate cofactors and controlling pH and ionic strength throughout the process.

What are the optimal expression systems for producing active recombinant Mycoplasma pneumoniae pgsA?

The optimal expression systems for producing active recombinant M. pneumoniae pgsA must address several challenges unique to mycoplasma proteins. E. coli expression systems require codon optimization to account for M. pneumoniae's use of UGA as a tryptophan codon rather than a stop codon . Insect cell expression systems (Baculovirus) may provide better post-translational modifications and membrane protein expression capabilities. For highest authenticity, researchers might consider approaches similar to those used in recombinant vaccine development for M. pneumoniae, where viral vectors have been successfully employed to express mycoplasma proteins . The expression construct should include appropriate purification tags, but these must be positioned to avoid interfering with enzyme activity. Temperature, induction timing, and media composition require careful optimization, as membrane-associated enzymes like pgsA can be challenging to express in active form. Researchers should validate enzyme activity immediately after purification using the established CDP-diacylglycerol—glycerol-3-phosphate 3-phosphatidyltransferase assay.

How can enzymatic activity of recombinant pgsA be accurately measured and compared to native enzyme?

Accurate measurement of recombinant pgsA enzymatic activity involves both direct and indirect approaches. Direct measurement typically utilizes radioisotope-labeled substrates (either 14C or 3H-labeled CDP-diacylglycerol) to monitor the formation of phosphatidylglycerol phosphate. The standard assay conditions should include optimal pH (usually 7.0-7.5), appropriate divalent cations (Mg2+ is typically required), and controlled temperature (usually 37°C for M. pneumoniae enzymes). For comparison with native enzyme, researchers should extract total membrane fractions from M. pneumoniae cultures to measure endogenous activity under identical conditions. Alternative non-radioactive methods include coupled enzyme assays that detect CMP release, or mass spectrometry-based approaches to measure substrate consumption and product formation. When comparing activities, researchers should normalize measurements to protein concentration and consider kinetic parameters (Km, Vmax) rather than single-point activity measurements to account for differences in substrate affinity that might occur between recombinant and native forms.

What potential pitfalls exist when designing inhibition studies against pgsA, and how can they be mitigated?

Inhibition studies against pgsA face several potential pitfalls. First, the hydrophobic nature of the enzyme's substrates and its association with membranes can lead to false positives through non-specific binding of lipophilic compounds or membrane disruption rather than specific enzyme inhibition. This can be mitigated by including appropriate controls with structurally similar non-inhibitory compounds and membrane integrity assays. Second, inhibitors might affect multiple phospholipid biosynthesis enzymes, leading to misinterpretation of specificity. Researchers should test inhibitors against related enzymes in the phospholipid biosynthesis pathway to establish selectivity profiles. Third, the artificial environment of in vitro assays might not reflect the enzyme's natural membrane context in M. pneumoniae. Using membrane preparations or reconstituted proteoliposomes rather than purified enzyme alone can provide more physiologically relevant results. Finally, the potential differences between recombinant and native enzyme, particularly in post-translational modifications, might affect inhibitor binding. Validation of promising inhibitors against whole M. pneumoniae cells, monitoring both growth inhibition and specific changes in phospholipid profiles, is essential for confirming on-target activity.

What structural features distinguish Mycoplasma pneumoniae pgsA from orthologous enzymes in other bacteria?

The structural features of M. pneumoniae pgsA reflect adaptations specific to the minimal genome and unique lifestyle of this wall-less pathogen. While the catalytic core of the enzyme remains conserved across bacterial species to maintain its essential transferase activity , M. pneumoniae pgsA likely shows differences in substrate binding regions that are adapted to the organism's distinct membrane composition. Unlike many bacteria that produce diverse phospholipids, M. pneumoniae has a streamlined phospholipid profile reflecting its parasitic lifestyle and reduced genome. The enzyme lacks regulatory domains found in some other bacteria, consistent with M. pneumoniae's generally simplified regulatory networks. Additionally, the membrane association domains of pgsA in M. pneumoniae may show unique features related to the unusual lipid composition of mycoplasma membranes, which typically contain a high proportion of cholesterol acquired from the host. These structural adaptations make M. pneumoniae pgsA an interesting target for comparative structural analysis, particularly for understanding how essential metabolic enzymes evolve in minimal genomes.

How does glycerophospholipid metabolism in Mycoplasma pneumoniae compare with other respiratory pathogens?

Glycerophospholipid metabolism in M. pneumoniae is significantly streamlined compared to other respiratory pathogens, reflecting its reduced genome and parasitic lifestyle. Unlike respiratory pathogens such as Streptococcus pneumoniae or Haemophilus influenzae that have complete phospholipid biosynthesis pathways , M. pneumoniae relies heavily on scavenging lipid precursors from its host. The pgsA enzyme represents one of the few retained biosynthetic capacities, highlighting its essential nature. The following table compares key aspects of phospholipid metabolism across respiratory pathogens:

CharacteristicM. pneumoniaeS. pneumoniaeH. influenzae
Genome size~0.8 Mb~2.1 Mb~1.8 Mb
Cell wallAbsentPresentPresent
De novo fatty acid synthesisLimitedCompleteComplete
Phospholipid diversityReducedModerateModerate
Cholesterol incorporationHighLow/NoneLow
Dependence on host lipidsHighLowModerate
pgsA pathway regulationMinimalComplexModerate

This comparative reduction in metabolic capacity means that pgsA and other retained phospholipid biosynthesis enzymes in M. pneumoniae are particularly promising targets for selective inhibition, as they represent metabolic bottlenecks with limited redundancy compared to other respiratory pathogens.

What post-translational modifications affect pgsA activity in Mycoplasma pneumoniae, and how can they be characterized?

Post-translational modifications (PTMs) of pgsA in M. pneumoniae may play critical roles in regulating enzyme activity, localization, and interactions within the phospholipid biosynthesis pathway. Though specific PTMs of pgsA have not been directly characterized in M. pneumoniae, other surface proteins in this organism are known to undergo modifications that affect their function. For instance, M. pneumoniae surface adhesins P1, P40, and P90 display sequence variations through homologous recombination mechanisms , and similar modification processes might affect metabolic enzymes like pgsA.

To characterize these modifications, researchers should employ a multi-faceted approach:

  • Mass spectrometry-based proteomics: High-resolution LC-MS/MS analysis of purified native pgsA can identify phosphorylation, acetylation, methylation, or other modifications. Enrichment techniques specific for each modification type can enhance detection sensitivity.

  • Site-directed mutagenesis: Converting putative modification sites (e.g., serine/threonine for phosphorylation) to non-modifiable residues and assessing effects on enzyme activity and localization.

  • Metabolic labeling: Incorporating modified amino acids or modification precursors followed by click chemistry to assess turnover and dynamics of modifications.

  • Comparative analysis: Examining enzyme properties under different growth conditions that might alter the PTM profile, such as nutrient limitation or host cell co-culture conditions.

These approaches would provide insights into how M. pneumoniae fine-tunes pgsA activity through post-translational mechanisms, potentially revealing novel regulatory mechanisms unique to this minimal genome pathogen.

How can recombinant pgsA be incorporated into novel vaccine strategies against Mycoplasma pneumoniae?

Recombinant pgsA presents a novel antigen candidate for M. pneumoniae vaccine development, complementing traditional approaches focused on the adhesin proteins P1 and P30. Current vaccine development efforts face challenges with poor immunogenicity and side effects of inactivated or attenuated M. pneumoniae vaccines . Incorporating pgsA into vaccine strategies could potentially address these limitations through several approaches:

First, recombinant pgsA could be incorporated into viral vector systems similar to the approach where M. pneumoniae P1a and P30a adhesin genes were inserted into influenza virus vectors . This approach leverages the immunogenicity of the viral vector while presenting M. pneumoniae antigens. For pgsA-based vaccines, careful selection of immunogenic epitopes is essential, as the entire enzyme may not be ideal for presentation. Computational prediction of epitopes followed by experimental validation would identify segments that generate protective rather than non-protective immune responses.

Second, multicomponent vaccines combining pgsA epitopes with established immunogens like P1 and P30 could potentially provide broader protection, targeting both adhesion and metabolic functions of the pathogen. This approach might reduce the likelihood of immune evasion through antigenic variation, which has been observed with surface adhesins of M. pneumoniae .

Third, rational protein engineering of pgsA to enhance immunogenicity while preserving protective epitopes could improve vaccine efficacy. Techniques such as epitope scaffolding, where critical epitopes are presented on stable protein frameworks, might enhance immune recognition of otherwise poorly immunogenic regions of metabolic enzymes.

What are the challenges in using heterologous expression systems for Mycoplasma pneumoniae pgsA, and how can they be overcome?

Heterologous expression of M. pneumoniae pgsA faces several significant challenges. The most fundamental is the alternative genetic code used by Mycoplasma, where the universal stop codon UGA is instead used as a codon for tryptophan . This creates premature termination when expressing mycoplasma genes in standard systems like E. coli. Additionally, pgsA as a membrane-associated enzyme presents solubility issues in heterologous systems.

These challenges can be overcome through several strategies:

  • Codon optimization: Systematic replacement of all UGA codons with UGG (standard tryptophan codon) in the pgsA gene sequence before expression in E. coli or other systems.

  • Fusion protein approaches: Creating fusions with solubility-enhancing partners like MBP (maltose-binding protein) or SUMO that can be later cleaved off using specific proteases.

  • Membrane mimetic systems: Expression in the presence of detergents, nanodiscs, or liposomes to provide a suitable environment for proper folding of the membrane-associated enzyme.

  • Alternative expression hosts: Systems like the Bacillus subtilis or Pseudomonas fluorescens-based expression platforms may provide better expression of membrane proteins than E. coli.

  • Cell-free expression systems: These can be programmed with modified translation machinery that recognizes the Mycoplasma genetic code, potentially allowing direct expression without codon modification.

Each approach requires optimization specific to pgsA, with careful monitoring of enzyme activity to ensure that the recombinant protein retains its native catalytic properties.

What is the relationship between pgsA activity and antibiotic resistance in Mycoplasma pneumoniae?

The relationship between pgsA activity and antibiotic resistance in M. pneumoniae is complex and multifaceted. As an enzyme involved in membrane phospholipid biosynthesis, pgsA influences the composition and properties of the cell membrane, which in turn affects the interaction of antibiotics with their targets. Several mechanisms may link pgsA activity to antibiotic resistance:

First, alterations in membrane phospholipid composition can affect membrane permeability to antibiotics. Many antibiotics used against M. pneumoniae, including macrolides and tetracyclines, must cross the cell membrane to reach their intracellular targets. Changes in phospholipid content resulting from altered pgsA activity could potentially modify membrane fluidity and permeability, affecting antibiotic entry.

Second, phospholipids interact directly with membrane proteins, including efflux pumps that can export antibiotics from the cell. Modifications in phospholipid composition may alter the function of these transporters, potentially enhancing or reducing their ability to confer resistance.

Third, some antibiotics specifically target cell membrane integrity. While M. pneumoniae lacks a cell wall and is intrinsically resistant to cell wall-targeting antibiotics, its membrane remains vulnerable to membrane-active antimicrobials. Changes in phospholipid composition through pgsA mutations or expression changes could modulate sensitivity to these agents.

To investigate these relationships experimentally, researchers should:

  • Generate M. pneumoniae strains with altered pgsA expression levels

  • Characterize membrane phospholipid profiles in these strains

  • Perform antibiotic susceptibility testing against multiple classes of antibiotics

  • Measure antibiotic penetration rates and intracellular accumulation

  • Analyze expression and activity of known resistance determinants in these modified strains

How can CRISPR-Cas9 technology be applied to study pgsA function in Mycoplasma pneumoniae?

CRISPR-Cas9 technology offers powerful approaches for investigating pgsA function in M. pneumoniae despite the technical challenges of genetic manipulation in this minimal genome organism. As pgsA likely catalyzes an essential step in membrane phospholipid biosynthesis, complete knockout may be lethal, necessitating more nuanced approaches:

  • Conditional expression systems: CRISPR-Cas9 can be used to replace the native pgsA promoter with inducible promoters, allowing controlled expression levels for studying enzyme essentiality and dose-dependent effects.

  • Domain-specific mutations: Rather than targeting the entire gene, CRISPR-Cas9 can introduce precise mutations in specific functional domains to dissect their contributions to enzyme activity and cellular physiology.

  • Tagged variant generation: CRISPR-Cas9 can efficiently introduce epitope or fluorescent protein tags to the endogenous pgsA gene, enabling studies of protein localization, interaction partners, and dynamics without overexpression artifacts.

  • Compensatory metabolism studies: Using CRISPR-Cas9 to modify pgsA in conjunction with supplementation of phospholipid precursors or end products can reveal the specific metabolic roles and potential bypass pathways.

  • Regulatory element identification: CRISPR interference (CRISPRi) approaches targeting non-coding regions around the pgsA gene can help identify regulatory elements controlling its expression.

Implementation requires careful design of guide RNAs accounting for M. pneumoniae's AT-rich genome, and delivery methods optimized for this wall-less bacterium. Electroporation protocols specifically developed for Mycoplasma species would likely provide the best transformation efficiency for CRISPR-Cas9 components.

What analytical techniques best differentiate between wild-type and recombinant pgsA activity?

Distinguishing between wild-type and recombinant pgsA activity requires complementary analytical approaches that examine both enzyme kinetics and product characterization. Advanced techniques include:

  • Enzyme kinetics analysis: Michaelis-Menten kinetics with varying concentrations of both substrates (CDP-diacylglycerol and sn-glycerol 3-phosphate) can reveal differences in Km, Vmax, and catalytic efficiency (kcat/Km) between wild-type and recombinant enzymes. Inhibition profiles using competitive and non-competitive inhibitors provide additional parameters for comparison.

  • Mass spectrometry-based phospholipid profiling: Ultra-high-performance liquid chromatography coupled with tandem mass spectrometry (UHPLC-MS/MS) can detect subtle differences in the phospholipid products generated by wild-type versus recombinant enzyme. This technique can identify variations in fatty acid incorporation patterns and minor product species that may differ between enzyme forms.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique measures the rate of hydrogen-deuterium exchange in proteins, providing insights into conformational dynamics and solvent accessibility differences between wild-type and recombinant enzymes.

  • Differential scanning fluorimetry (DSF): Thermal stability profiles can reveal structural differences between wild-type and recombinant enzymes, particularly when measured in the presence of substrates, products, or potential inhibitors.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC): These techniques provide detailed binding parameters for substrate interactions, potentially revealing subtle differences in binding mechanisms or affinities.

When applying these techniques, it's essential to ensure that both enzyme preparations are analyzed under identical conditions, with appropriate normalization for protein concentration and specific activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.