Recombinant Mycoplasma pneumoniae P30 adhesin (p30)

Shipped with Ice Packs
In Stock

Description

Functional Role in Pathogenesis

As a terminal organelle component, recombinant P30 retains the native protein's ability to:

  • Mediate adhesion to sialoglycoproteins and sulfated glycolipids on host cells

  • Stabilize the P1-P65 adhesin complex required for gliding motility

  • Induce cytoskeletal rearrangements in epithelial cells through signal transduction

Mutational studies show that deletions in the proline-rich C-terminal region abolish adhesion capacity, confirming this domain's functional importance .

Diagnostic Applications

Recombinant P30 exhibits high diagnostic utility:

  • Serological Testing: Shows 78.57% sensitivity and 89.47% specificity in ELISA when combined with other adhesins .

  • Antigenic Performance: Recognized by 100% of M. pneumoniae-positive patient sera in immunoblot assays .

  • Cross-Reactivity Reduction: Purified recombinant form minimizes false positives compared to whole-cell lysates .

Comparative studies demonstrate enhanced specificity when used in combination with P1 and P116 adhesins for IgM/IgG detection .

Vaccine Development Potential

Experimental vaccine candidates using recombinant P30 show:

  • Induction of protective IgA in guinea pig respiratory mucosa

  • 60–75% reduction in bacterial load in murine challenge models

  • Th17-mediated immunopathology risks requiring attenuation strategies

Chimeric proteins combining P30 with P1 adhesin regions (e.g., P1 aa 1287–1518 + P30 aa 17–274) demonstrate improved immunogenicity and adhesion-inhibition properties .

Key Research Findings

Recent advances highlight:

  • Structural Insights: Cryo-EM studies reveal P30's role in organizing the terminal organelle architecture

  • Host-Pathogen Interactions: P30 binds β4 integrins on respiratory epithelium, triggering IL-8 production

  • Antibody Escape Mechanisms: Proline-rich repeats undergo phase variation to evade immune detection

Ongoing clinical trials focus on optimizing P30-containing subunit vaccines and developing rapid P30 antigen capture assays for point-of-care diagnostics .

Product Specs

Buffer
The default storage buffer for liquid delivery form is a Tris/PBS-based buffer containing 5%-50% glycerol. For lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement in the order notes. We will fulfill your request if possible.
Lead Time
18-23 business days
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
p30; MPN_453; MP388; P30 adhesin; 30 kDa adhesin-related protein; Cytadhesin P30
Datasheet & Coa
Please contact us to get it.
Expression Region
1-274aa
Mol. Weight
32.6 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Source
in vitro E.coli expression system
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
p30
Target Protein Sequence
MKLPPRRKLKLFLLAWMLVLFSALIVLATLILVQHNNTELTEVKSELSPLNVVLHAEEDTVQIQGKPITEQAWFIPTVAGCFGFSALAIILGLAIGLPIVKRKEKRLLEEKERQEQLAEQLQRISAQQEEQQALEQQAAAEAHAEAEVEPAPQPVPVPPQPQVQINFGPRTGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMPPHPGMAPRPGFPPQPGMAPRPGMQPPRPGMPPQPGFPPKR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This adhesin plays a crucial role in successful cytadherence and virulence.
Gene References Into Functions
  1. Posttranslational processing is essential for P30 to fully function in cell gliding and cytadherence. PMID: 21821772
Database Links

KEGG: mpn:MPN453

Subcellular Location
Cell projection, attachment organelle membrane; Multi-pass membrane protein. Note=Integral and surface exposed membrane protein that localizes to the membrane at the attachment organelle.

Q&A

What is the molecular structure and primary function of P30 adhesin in M. pneumoniae?

P30 is a transmembrane protein with 275 amino acids and a molecular mass of approximately 29.7 kDa. The protein has a genome size of 825 bp with a G+C content of 54.4%, similar to the 53.5% G+C content of the P1 adhesion protein . P30 exhibits a distinctive orientation, with its N-terminus situated in the cytoplasm and C-terminus exposed on the cell surface .

The protein contains three distinctive proline-rich repeat sequences at its carboxy terminus:

  • Repeat A region: PGMAPR (occurring seven times)

  • Repeat B region: PGMPPH (occurring three times)

  • Repeat C region: PGEPPQ (occurring three times)

Functionally, P30 is critical for:

  • Cell adhesion to host respiratory epithelium

  • Gliding motility of M. pneumoniae

  • Virulence and pathogenicity

  • Signal transduction to host cells

As the second protein identified (after P1) that is associated with cell adhesion, P30 is positioned at the tip of M. pneumoniae's terminal organelle and enables the pathogen to adhere to sialoglycoproteins and sulfated glycolipids on host cell surfaces .

How is the p30 gene structured and regulated within the M. pneumoniae genome?

The p30 gene (MPN453) is located within the high-molecular-weight (HMW) genome region of M. pneumoniae. Its expression is complexly regulated and interconnected with other genes:

  • The gene requires a promoter-like region upstream of P21 in the HMW genome for proper expression

  • A regulatory sequence 13 bp downstream of the P30 gene is associated with HMW3 expression

  • P30 and HMW3 transcription are interdependent, demonstrating coordinated regulation

Notably, sequence analysis of clinical samples reveals genetic diversity in the p30 gene. In one study of 18 Indian asthmatic patients, 16 showed sequence variations when compared to the reference strain M-129 . This suggests the gene may be under selective pressure or undergoes genetic drift during infection.

For researchers interested in genomic analyses, primers for p30 amplification have been established:

  • Forward primer P30-EF1: 5′-CCATGGGACCATGAAGTTACCACCTCGAAGAAAGCTTAAACTGTTTTTATTAGCCTGGATG-3′

  • Reverse primer P30-ER1: 5′-GTCGACTGCAGCGTTTTGGTGGAAAACCGGGTTG-3′

Which expression systems are most effective for producing recombinant P30 protein?

Multiple expression systems have been successfully employed for recombinant P30 production, each with distinct advantages:

Bacterial Expression Systems

E. coli expression systems using vectors such as pQE-30 and pMAL-p2x have been successfully employed for P30 production. The pMAL-p2x fusion vector system allows the expression of P30 as a maltose-binding protein (MBP) fusion, which can enhance solubility .

When designing expression constructs for E. coli, researchers must consider the UGA codon region of the p30 gene, which can be problematic due to different codon usage between Mycoplasma and E. coli. Primers can be designed to exclude this region, as demonstrated with primer P30-EF2: 5′-CCATGGGATCCGCAACCTTAATTTTGGTACAGCAC-3′ .

Yeast Expression System

A yeast expression system has also proven effective for producing recombinant P30 protein fragments. This system has been used to express the C-terminal region (amino acids 106-274) with a C-terminal 6xHis tag, resulting in a protein with >85% purity as determined by SDS-PAGE .

Selection and Purification Methodology:

For bacterial systems:

  • Transformants can be selected on LB agar plates containing 100 μg/ml ampicillin and 25 μg/ml kanamycin (for pQE-30 vector)

  • For pMAL-p2x fusion vector, selection can be done with 100 μg/ml ampicillin

For both systems, chromatographic purification yields high-purity protein suitable for immunological studies.

What functional and structural roles do the proline-rich repeats play in P30 protein?

The C-terminus of P30 contains three distinctive types of proline-rich repeat sequences that serve critical functions:

Repeat TypeSequenceFrequencyFunction
Repeat APGMAPR7 occurrencesSurface exposure, adhesion
Repeat BPGMPPH3 occurrencesSurface exposure, adhesion
Repeat CPGFPPQ3 occurrencesSurface exposure, adhesion

These proline-rich repeats are significant for several reasons:

  • Surface Accessibility: Whole-cell radioimmunoprecipitation studies have demonstrated that antibodies directed against these proline-rich repeat sequences can bind to intact mycoplasmas, confirming their surface exposure and accessibility .

  • Functional Importance: Mutation analyses reveal that truncated forms of P30 lacking these repeats show altered functionality. A mutant subclass expressing a truncated 25-kDa peptide (missing 8 of the 13 proline-rich repeats) demonstrated compromised adhesion properties .

  • Immunological Significance: These exposed repeats likely contribute to the protein's immunogenicity, making them potential targets for antibody detection in diagnostic applications .

  • Cross-reactivity Potential: The proline-rich sequences may contribute to the cross-reactive epitopes shared between P30 and eukaryotic structural proteins like fibrinogen, keratin, and myosin, potentially explaining some post-infection autoimmune responses .

How can recombinant P30 be utilized for immunodiagnosis of M. pneumoniae infections?

Recombinant P30 shows considerable promise as a diagnostic antigen for M. pneumoniae infections due to its high immunogenicity and surface exposure.

Diagnostic Performance:

In a comparative study with a commercial kit (Serion ELISA Classic), an in-house ELISA using MBP-P30B fusion protein demonstrated:

  • Sensitivity: 78.57%

  • Specificity: 89.47%

This performance suggests that P30 can be an effective antigen for serological diagnosis, particularly when used in combination with other adhesin proteins.

Methodological Implementation:

  • Protein Expression: Express the C-terminal fragment of P30 (which includes the complete proline-rich sequences) as a fusion protein in an appropriate expression system.

  • Purification Protocol: Chromatographic methods yield highly purified protein suitable for diagnostic applications.

  • Immunoassay Format: The MBP-P30B fusion protein has been successfully utilized in both immunoblot and ELISA formats for detecting M. pneumoniae-specific antibodies in patient sera .

  • Combined Antigen Approach: Research suggests that combining P30 with other adhesin proteins in a multi-antigen assay may enhance diagnostic sensitivity and specificity.

The exposed C-terminus of P30 generates robust immune responses in M. pneumoniae-infected patients, making it particularly valuable for immunodetection methods .

What advanced strategies can optimize the yield and functionality of recombinant P30 protein?

Optimizing recombinant P30 expression requires consideration of several advanced strategies:

Codon Optimization

The p30 gene contains UGA codons which encode tryptophan in Mycoplasma but function as stop codons in standard expression systems. Researchers have successfully addressed this by:

  • Designing expression primers that exclude UGA codon regions

  • Using synthetic genes with optimized codons for the expression host

Expression of Functional Domains

Rather than expressing the full-length protein, targeting specific functional domains can improve yield and solubility:

  • The C-terminal region (amino acids 106-274) containing the proline-rich repeats has been successfully expressed while maintaining immunological properties

  • This approach circumvents difficulties associated with transmembrane domains

Fusion Tag Selection

The choice of fusion tag significantly impacts protein solubility and functionality:

  • Maltose-binding protein (MBP) fusion has proven effective for maintaining P30 immunoreactivity

  • His-tagged constructs facilitate purification but may affect protein folding

Post-Purification Processing

For optimal stability and functionality:

  • Add 5-50% glycerol to the final preparation

  • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

  • For lyophilized preparations, reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

How do genetic variations in p30 affect protein function and pathogenicity?

Sequence diversity in the p30 gene has been observed across clinical isolates, with potential implications for protein function and pathogenicity:

Documented Sequence Variations:

In a study of 18 Indian asthmatic patients, 16 clinical samples showed sequence diversity in their p30 genes compared to the reference strain M-129 . These variations may represent:

  • Adaptations to selective pressures within the host

  • Geographic strain differences

  • Disease-associated mutations

Functional Impact Assessment:

Truncation mutations have demonstrated clear functional consequences:

  • A mutant subclass expressing a 25-kDa truncated peptide (missing 48 amino acids from the C-terminus) showed altered adhesion properties

  • This truncated P25 peptide (227 amino acids, 24,823 Da) lacked 8 of the 13 proline-rich repeat sequences at the carboxy terminus

  • These mutants were hemadsorption-negative (HA-), indicating compromised adhesion capability

Methodological Approach to Studying Variations:

  • Direct Sequencing from Clinical Samples: Amplify the p30 gene directly from clinical specimens using established primers

  • Multiple Independent Sequencing: Perform at least three independent amplification and sequencing reactions for each sample to confirm variations

  • Comparative Analysis: Use bioinformatic tools (such as Clustal W and Gene Doc) to compare sequences with reference strains

  • Protein Translation Analysis: Translate nucleotide sequences using Mycoplasma coding tables to identify amino acid changes

Understanding these variations is essential for developing broadly effective diagnostic tools and therapeutic interventions.

What experimental approaches can elucidate P30-host cell interactions?

Investigating P30-host cell interactions requires multiple complementary approaches:

Adhesion Assays

P30 mediates attachment to sialoglycoproteins and sulfated glycolipids on host cell surfaces. To study this:

  • Cell binding assays using recombinant P30 proteins

  • Competitive inhibition studies with P30-specific antibodies

  • Glycan array screening to identify specific receptor molecules

Protein-Protein Interaction Studies

P30 interactions with host cell components can be investigated through:

  • Pull-down assays using recombinant P30 proteins

  • Co-immunoprecipitation of P30 with potential host binding partners

  • Surface plasmon resonance (SPR) to determine binding kinetics and affinities

Mutational Analysis

Systematic mutation of P30 domains provides insight into functional regions:

  • Site-directed mutagenesis of conserved residues

  • Deletion constructs of proline-rich repeats

  • Domain swapping experiments between related adhesins

Structural Biology Approaches

Understanding the three-dimensional structure of P30:

  • X-ray crystallography of recombinant protein domains

  • Cryo-electron microscopy of P30 in complex with receptor molecules

  • Molecular dynamics simulations to model protein-receptor interactions

Cross-Reactivity Studies

Investigating the molecular basis for autoimmune responses:

  • Epitope mapping of shared sequences between P30 and human proteins

  • Analysis of antibody cross-reactivity between P30 and human fibrinogen, keratin, and myosin

These approaches collectively provide a comprehensive view of how P30 mediates pathogen-host interactions and contributes to M. pneumoniae pathogenesis.

How can recombinant P30-based diagnostic assays be optimized for clinical applications?

Optimizing P30-based diagnostic assays requires attention to several key parameters:

Antigen Selection and Design

The choice of P30 fragment significantly impacts assay performance:

  • Focus on the C-terminal region containing the proline-rich repeats, which is surface-exposed and highly immunogenic

  • Express amino acids 106-274 to include all immunodominant epitopes

  • Consider a fusion protein approach (e.g., MBP-P30B) to enhance stability and immunoreactivity

Performance Benchmarking

When developing new assays, comparison with established methods is essential:

  • An MBP-P30B ELISA demonstrated 78.57% sensitivity and 89.47% specificity compared to a commercial kit

  • This indicates good performance but suggests room for optimization

Multi-Antigen Approach

Combining P30 with other M. pneumoniae antigens can enhance diagnostic accuracy:

  • "This study suggests that the P30 protein can be used as an antigen along with other adhesin proteins for the immunodiagnosis of M. pneumoniae infection"

  • P1 adhesin is a logical complement to P30 in multi-antigen assays

Assay Format Selection

Different immunoassay formats offer various advantages:

  • ELISA provides quantitative results suitable for high-throughput screening

  • Immunoblot offers higher specificity but lower throughput

  • Point-of-care rapid tests require optimization for sensitivity without laboratory equipment

Clinical Validation Strategy

Rigorous validation is essential for transitioning to clinical applications:

  • Test with diverse patient populations

  • Include samples from various disease stages

  • Compare with culture and PCR-based methods as reference standards

What strategies can overcome challenges in purifying recombinant P30 while maintaining native conformation?

Purifying recombinant P30 presents several challenges that require specific strategies:

Solubility Enhancement

The transmembrane nature of P30 can create solubility issues:

  • Express specific domains (e.g., C-terminal region) rather than the full-length protein

  • Use solubility-enhancing fusion partners such as maltose-binding protein (MBP)

  • Add low concentrations of mild detergents during extraction and purification

Chromatographic Purification

Multi-step chromatography ensures high purity:

  • Affinity chromatography (using His-tag or MBP fusion) for initial capture

  • Ion-exchange chromatography for intermediate purification

  • Size-exclusion chromatography as a polishing step

Conformational Stability

Maintaining native protein conformation is critical for functional studies:

  • Buffer optimization with stabilizing agents (5-50% glycerol)

  • Use of trehalose (6%) for lyophilized preparations

  • pH control (typically pH 8.0 for optimal stability)

Quality Assessment

Rigorous quality control ensures consistent protein preparations:

  • SDS-PAGE analysis (>85% purity standard)

  • Western blotting to confirm identity and integrity

  • Functional assays to verify biological activity

Storage Optimization

Proper storage conditions prevent degradation:

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Maintain long-term storage at -20°C/-80°C

What approaches can leverage P30 adhesin for vaccine development against M. pneumoniae?

P30 offers significant potential for vaccine development due to its surface exposure, immunogenicity, and role in pathogenesis. Several approaches merit consideration:

Subunit Vaccine Approach

Using recombinant P30 as a subunit vaccine component:

  • Focus on the C-terminal immunogenic region containing proline-rich repeats

  • The surface accessibility of this region makes it a prime target for neutralizing antibodies

  • Combine with other adhesins (particularly P1) for broader protection

Immunogenicity Enhancement

Strategies to boost immune responses:

  • Conjugation to carrier proteins

  • Incorporation into adjuvant systems

  • Design of multi-epitope constructs targeting both B and T cell responses

Addressing Antigenic Variation

Sequence diversity in p30 across clinical isolates presents challenges:

  • Identify conserved epitopes across various strains

  • Consider multivalent approaches incorporating variant sequences

  • Focus on functionally constrained regions less prone to mutation

Cross-Reactivity Considerations

The documented cross-reactivity between P30 and human proteins raises safety concerns:

  • Map and exclude epitopes shared with fibrinogen, keratin, and myosin

  • Screen vaccine candidates for autoimmune potential

  • Monitor for autoimmune responses in preclinical studies

Delivery Platform Selection

Various platforms could be suitable for P30-based vaccines:

  • Recombinant protein formulations with appropriate adjuvants

  • DNA vaccines encoding optimized p30 sequences

  • Viral vector-based delivery systems

What methods most effectively evaluate P30 surface exposure and accessibility?

Understanding P30 surface exposure is crucial for both basic research and applied studies. Several complementary methods provide robust evidence:

Whole-Cell Antibody Binding Assays

Radioimmunoprecipitation studies have conclusively demonstrated that:

  • Antibodies directed against the proline-rich repeat sequences at the carboxy terminus successfully bind intact mycoplasmas

  • In contrast, antibodies generated against N-terminal amino acid sequences do not bind to intact mycoplasmas

  • This differential binding pattern confirms the transmembrane topology with surface-exposed C-terminus

Protease Accessibility Testing

Surface-exposed regions can be identified through:

  • Limited proteolysis of intact cells

  • Mass spectrometry analysis of cleaved fragments

  • Comparison with proteolysis patterns of lysed cells

Immunofluorescence Microscopy

Visualization of surface-exposed domains:

  • Immunolabeling of intact cells versus permeabilized cells

  • Confocal microscopy to confirm surface localization

  • Co-localization with other known surface proteins

Flow Cytometry

Quantitative assessment of surface exposure:

  • Antibody binding to intact bacteria measured by flow cytometry

  • Comparison of binding patterns across different strains

  • Evaluation of surface exposure changes under different conditions

Computational Prediction

Bioinformatic approaches complement experimental methods:

  • Transmembrane topology prediction algorithms

  • Hydropathy analysis to identify membrane-spanning regions

  • Structural modeling of protein domains

How do mutations in the p30 gene affect M. pneumoniae virulence and pathogenicity?

Mutations in the p30 gene have demonstrated significant impacts on virulence and pathogenicity:

Hemadsorption-Negative Phenotypes

Spontaneous, hemadsorption-negative (HA-) class II M. pneumoniae mutants display:

  • P30 adhesin-deficient protein profiles

  • Reduced ability to adhere to erythrocytes

  • Compromised virulence potential

Truncation Mutations

Analysis of mutant subclasses reveals two distinct patterns:

  • One subclass possesses the entire p30 structural gene without alterations but fails to express the protein

  • A second subclass contains a deletion in p30 resulting in the expression of a truncated 25-kDa peptide (227 amino acids) lacking 8 of the 13 proline-rich repeat sequences

Functional Consequences

These mutations result in:

  • Impaired cytadherence to host respiratory epithelium

  • Compromised gliding motility

  • Reduced virulence and pathogenicity

  • Altered interactions with host immune system

Regulatory Mutations

Some P30-deficient mutants contain intact structural genes but show altered expression, suggesting:

  • Mutations in regulatory sequences may affect p30 expression

  • Interdependent transcription with other genes (like HMW3) means mutations in partner genes can affect P30 expression

Understanding these mutations provides insight into the molecular basis of M. pneumoniae pathogenesis and may reveal targets for therapeutic intervention.

What is the relationship between P30 structure and its role in M. pneumoniae gliding motility?

P30 plays a crucial role in the gliding motility of M. pneumoniae, which enables the pathogen to move from the tips of epithelial cilia to host cell surfaces:

Terminal Organelle Association

P30 is localized to the differentiated terminal organelle of M. pneumoniae, which is:

  • Essential for both cytadherence and gliding motility

  • A specialized structure at the leading end of the cell

  • The site where coordinated protein interactions drive motility

Structural Requirements

The specific structural elements of P30 that contribute to motility include:

  • The proline-rich repeat sequences at the C-terminus, which provide flexibility and surface exposure

  • Transmembrane orientation, with the N-terminus in the cytoplasm enabling interaction with internal motility machinery

  • Potential interaction with cytoskeletal elements or motor proteins

Functional Evidence

The role of P30 in motility is supported by:

  • Hemadsorption-negative mutants with P30 deficiencies show impaired motility

  • The P30 protein shares functions with P1 adhesin in gliding movement

  • Truncated P30 variants lacking C-terminal repeats demonstrate compromised motility

Cooperative Protein Interactions

P30 doesn't function in isolation but cooperates with other proteins:

  • Interdependent relationship with HMW3 expression suggests coordinated roles in motility

  • Stability of the P65 protein is related to P30, indicating a complex protein network involved in movement

How can the cross-reactivity between P30 and human proteins be studied to understand autoimmune responses?

The documented cross-reactivity between P30 adhesin and human structural proteins provides a potential molecular basis for post-infectious autoimmunity associated with M. pneumoniae infections:

Epitope Mapping Approach

To identify specific cross-reactive regions:

  • Generate overlapping peptides spanning the P30 sequence

  • Test reactivity against patient sera and monoclonal antibodies

  • Compare with corresponding sequences in human fibrinogen, keratin, and myosin

Structural Analysis Methods

Understanding structural similarities:

  • X-ray crystallography or NMR of P30 domains

  • Computational structural alignment with human proteins

  • Molecular modeling of cross-reactive epitopes

Immunological Assessment

Characterizing the immune response:

  • Analysis of antibody cross-reactivity using purified proteins

  • T-cell reactivity studies with overlapping peptides

  • Cytokine profiling to assess inflammatory responses

Clinical Correlation Studies

Connecting laboratory findings with clinical observations:

  • Compare antibody profiles in patients with and without post-infectious autoimmune manifestations

  • Longitudinal studies tracking antibody evolution during and after infection

  • Case-control studies of autoimmune complications following M. pneumoniae infection

Animal Models

Experimental systems to test autoimmune hypotheses:

  • Immunization with P30 to assess development of cross-reactive antibodies

  • Challenge experiments to determine if P30 immunization predisposes to autoimmune pathology

  • Passive transfer of anti-P30 antibodies to evaluate pathogenic potential

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.