Recombinant Mycoplasma pneumoniae Probable ABC transporter permease protein MG189 homolog (MPN_136)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Operon Organization

MPN_136 is part of the mpn133–mpn136 operon, which encodes:

  • MPN133: A lipoprotein of unknown function.

  • MPN134 (UgpC): ABC transporter ATP-binding protein.

  • MPN135 (UgpA): Permease component.

  • MPN136: Probable permease (this protein).

This operon was initially annotated as a Ugp glycerol-3-phosphate (G3P) ABC transporter but later found to lack G3P utilization capability in M. pneumoniae . Genetic studies indicate that mpn134, mpn135, and mpn136 are essential genes, as knockouts were unobtainable .

Functional Role in ABC Transporters

ABC transporters typically consist of:

  1. Transmembrane domains (TMDs): Form substrate channels (MPN_136 and MPN135).

  2. Nucleotide-binding domains (NBDs): Hydrolyze ATP (MPN134/UgpC).

MPN_136 likely facilitates substrate recognition and translocation. While its exact substrate remains unclear, proteomic studies link it to glycerophosphodiester (GPC) or phospholipid metabolism . Key findings:

  • MPN_136 is upregulated in glpQ mutants defective in glycerophosphodiesterase activity, suggesting compensatory metabolic regulation .

  • It interacts with MPN284, a lipoprotein implicated in GPC transport .

Comparative Analysis of M. pneumoniae ABC Transporters

ProteinGeneRoleSubstrate SpecificityEssential?
MPN134ugpCATP-bindingUnknown (possibly phospholipids)Yes
MPN135ugpAPermeaseUnknownYes
MPN136ugpEPermeaseUnknownYes
MPN421glpUGPC transporterGlycerophosphocholine (GPC)No

Sources:

Research Applications

  • Functional Studies: Used to dissect ABC transporter mechanisms in M. pneumoniae .

  • Structural Biology: Purified recombinant MPN_136 enables crystallography or cryo-EM to resolve permease architecture .

  • Drug Development: Potential target for disrupting nutrient uptake in M. pneumoniae .

Unresolved Questions

  1. What specific substrate(s) does the MPN133–MPN136 transporter complex translocate?

  2. How does MPN_136 interact with MPN284 or other lipoproteins?

  3. Does this transporter contribute to virulence or host adaptation?

Current research focuses on integrating metabolomic and structural data to address these gaps .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific requests. Please indicate your desired format in your order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on your purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms exhibit a shelf life of 6 months when stored at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MPN_136; E07_orf319; MP018; Probable ABC transporter permease protein MG189 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_136
Target Protein Sequence
MFKQSLIWYNRYVQKRKKGLDLTIKDRSWSNVLLGLIFKTVVLCFFGLMVIFPFYLMLVV ALTSDEVVLNIREPILKSDGWHFENFRRVLEDGKYLNAIWINSLVTILSIILRLFFTVSM GYAFSLKKWKLKKLFWFIFLAVLILPESALLIGQYRVVVVANWNQPEKPAIILGLTMPFV ASVFSGFMFRTAFEAIPPRIKESAFVDGCTGLRYFLKIAFPMVRSTTWTVSILTAFAAWN SYLWPLLLLTNRPDLNINLWVLAQGTDGNAGQSDEQIRVLLNLKMAAAILAILPMFIVYF LFRKRIMKAVGSRANTIKG
Uniprot No.

Target Background

Function
This protein is likely a component of a binding-protein-dependent transport system. It is believed to facilitate the translocation of its substrate across the membrane.
Database Links

KEGG: mpn:MPN136

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MPN_136 and what is its role in Mycoplasma pneumoniae?

MPN_136 (UniProt ID: P75262) is a probable ABC transporter permease protein in Mycoplasma pneumoniae that functions as part of the ATP-binding cassette (ABC) transporter superfamily. ABC transporters represent one of the largest superfamilies of active membrane transport proteins with a highly conserved ATPase domain that binds and hydrolyzes ATP, providing energy for nutrient uptake and extrusion of drugs and metabolic wastes . MPN_136 specifically serves as a permease component, forming the transmembrane channel through which substrates are transported across the membrane. In M. pneumoniae, this protein is homologous to the MG189 protein found in Mycoplasma genitalium .

How does MPN_136 relate to other ABC transporters in Mycoplasma species?

MPN_136 is part of a larger group of ABC transporters that constitute a significant portion of membrane transport proteins in Mycoplasma species. Studies have revealed high percentages of coding sequences encoding membrane transport proteins in different Mycoplasma strains, with M. hyopneumoniae strains J and 7448 containing 13.4% and 13.8% respectively, and M. synoviae strain 53 containing 11.2% . Among these transport proteins, ABC systems represent between 85.0% and 88.6% of those coding sequences . MPN_136 specifically functions as a permease component, forming the transmembrane channel of an ABC transporter system. The high conservation of ABC transporters across Mycoplasma species suggests their essential role in the survival and pathogenicity of these organisms.

What are the optimal conditions for recombinant expression of MPN_136?

The recombinant expression of MPN_136 has been successfully achieved in E. coli expression systems . For optimal expression, the following protocol is recommended:

  • Clone the full-length MPN_136 gene (encoding amino acids 1-319) into an appropriate expression vector with an N-terminal His-tag

  • Transform the construct into a compatible E. coli strain optimized for membrane protein expression (such as C41(DE3) or BL21(DE3) pLysS)

  • Grow cultures at 37°C until reaching OD600 of 0.6-0.8

  • Induce protein expression with IPTG (0.5-1.0 mM) at reduced temperature (16-18°C) overnight to minimize inclusion body formation

  • Harvest cells by centrifugation and proceed with membrane fraction isolation

This methodology maximizes the yield of properly folded recombinant protein while minimizing toxicity to the host cells that often occurs with membrane protein overexpression .

What purification strategies yield the highest purity of recombinant MPN_136?

The purification of His-tagged MPN_136 can be achieved through a multi-step process designed to isolate the protein from the E. coli membrane fraction:

  • Resuspend cell pellets in a low-salt buffer and lyse using sonication or a French press

  • Centrifuge to separate the membrane fraction (pellet) from soluble proteins

  • Extract the membrane-bound MPN_136 using a high-salt buffer containing a detergent (such as n-dodecyl-β-D-maltoside or Triton X-100)

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • For higher purity (>90%), implement a secondary purification step such as size exclusion chromatography

This protocol typically yields MPN_136 with greater than 90% purity as determined by SDS-PAGE analysis .

How should purified MPN_136 be stored to maintain stability and activity?

For optimal stability, purified MPN_136 should be stored following these guidelines:

  • Lyophilization in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot and store at -20°C/-80°C for long-term storage

  • Avoid repeated freeze-thaw cycles, as they significantly reduce protein activity

  • For working solutions, store aliquots at 4°C for up to one week

This storage protocol preserves both the structural integrity and functional activity of the recombinant protein.

What experimental approaches can be used to characterize MPN_136 transport activity?

Several methodologies can be employed to investigate the transport function of MPN_136:

  • Liposome Reconstitution Assays: Purified MPN_136 can be reconstituted into proteoliposomes along with the ATP-binding component of the ABC transporter. Transport activity can then be measured by monitoring the uptake or efflux of fluorescently labeled or radioactive substrates.

  • ATPase Activity Assays: While MPN_136 itself is not the ATP-hydrolyzing component, its interaction with the ATP-binding protein can be studied by measuring ATP hydrolysis rates in the presence of potential substrates.

  • Substrate Binding Assays: Techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can be used to identify and characterize potential substrates that interact with MPN_136.

  • Fluorescence-based Transport Assays: Using fluorescent probes or pH-sensitive dyes to monitor substrate movement across membranes containing reconstituted MPN_136.

These approaches provide complementary information about the substrate specificity and transport kinetics of MPN_136 .

How can researchers investigate the role of MPN_136 in Mycoplasma pneumoniae pathogenicity?

To elucidate the role of MPN_136 in pathogenicity, researchers can employ several strategies:

  • Gene Knockout/Knockdown Studies: Creating MPN_136-deficient M. pneumoniae strains and comparing their virulence to wild-type strains in appropriate infection models.

  • Comparative Genomics: Analyzing the conservation and variation of MPN_136 sequences across pathogenic and non-pathogenic Mycoplasma strains to identify correlations with virulence.

  • Host-Pathogen Interaction Assays: Investigating how MPN_136 may contribute to adhesion, invasion, or persistence of M. pneumoniae in host cells.

  • Substrate Identification: Determining which host-derived molecules are transported by MPN_136-containing ABC transporters, particularly focusing on nutrients that may be essential for survival within the host environment.

Studies have shown that ABC transporters in Mycoplasma species are involved in nutrient acquisition and can be associated with virulence mechanisms, suggesting MPN_136 might play a similar role in pathogenicity .

What is known about the relationship between MPN_136 and antibiotic resistance?

ABC transporters often contribute to antimicrobial resistance through efflux mechanisms. While specific data on MPN_136's role in antibiotic resistance is limited, several approaches can be used to investigate this relationship:

  • Minimum Inhibitory Concentration (MIC) Assays: Comparing antibiotic susceptibility between wild-type and MPN_136-deficient strains.

  • Drug Efflux Assays: Using fluorescent antibiotics or labeled compounds to directly measure efflux activity of reconstituted MPN_136.

  • Resistance Development Studies: Exposing M. pneumoniae to sub-lethal concentrations of antibiotics and monitoring changes in MPN_136 expression or sequence.

Research in related Mycoplasma species has identified ABC systems that include both drug and multidrug resistant systems (MDR), which represent mechanisms of resistance to toxic molecules . It is reasonable to hypothesize that MPN_136 might function in similar resistance mechanisms in M. pneumoniae.

What structural features are critical for MPN_136 function as a permease component?

MPN_136 contains several critical structural features typical of ABC transporter permease components:

  • Transmembrane Domains (TMDs): Hydrophobicity analysis of the MPN_136 sequence reveals multiple predicted membrane-spanning regions that form the substrate translocation pathway.

  • Coupling Helices: These interact with the nucleotide-binding domains (NBDs) of the ATP-binding component, allowing conformational changes from ATP hydrolysis to be transmitted to the permease.

  • Substrate-Binding Pocket: Specific residues within the transmembrane regions likely form a binding site that determines substrate specificity.

  • Dimerization Interface: As ABC transporters typically function with two permease subunits, MPN_136 contains regions that mediate homodimerization or heterodimerization with other permease components.

Understanding these structural elements is essential for elucidating the transport mechanism and substrate specificity of MPN_136 .

What protein-protein interactions are essential for MPN_136 function in the ABC transporter complex?

MPN_136 participates in several critical protein-protein interactions within the ABC transporter complex:

  • Permease-Permease Interactions: MPN_136 likely forms homodimers or heterodimers with other permease subunits to create the complete transmembrane channel.

  • Permease-NBD Interactions: MPN_136 must interact with the nucleotide-binding domain proteins that bind and hydrolyze ATP, typically through coupling helices that transmit conformational changes.

  • Substrate-Binding Protein Interactions: Some ABC importers require additional periplasmic or membrane-anchored substrate-binding proteins that initially capture the substrate and deliver it to the permease.

  • Regulatory Protein Interactions: MPN_136 function may be modulated by interactions with regulatory proteins that respond to cellular conditions.

These interactions collectively determine the transport efficiency, substrate specificity, and regulation of the ABC transporter complex containing MPN_136 .

How does MPN_136 compare to its homologs in other Mycoplasma species?

MPN_136 shares significant homology with permease components in other Mycoplasma species, particularly with MG189 in Mycoplasma genitalium . Comparative analysis reveals:

SpeciesHomologSequence IdentitySequence SimilarityFunction
M. genitaliumMG189~79%~90%Probable ABC transporter permease
M. hyopneumoniaeSeveral homologs35-45%55-65%ABC transporter components
M. synoviaeSeveral homologs30-40%50-60%ABC transporter components

What evolutionary insights can be gained from studying MPN_136 and related ABC transporters?

Evolutionary analysis of MPN_136 and related ABC transporters in Mycoplasma species offers several insights:

  • Genome Reduction: Mycoplasmas have undergone extensive genome reduction, yet they retain a high percentage of ABC transporters, indicating the essential nature of these systems for survival in their specialized niches.

  • Horizontal Gene Transfer: Some ABC transporters in Mycoplasma may have been acquired through horizontal gene transfer, potentially conferring advantages in host adaptation.

  • Selective Pressure: The pattern of conservation and variation in MPN_136 homologs can reveal regions under selective pressure, which may correlate with substrate binding sites or host-specific adaptations.

  • Functional Divergence: Comparative analysis can identify instances where homologous transporters have evolved different substrate specificities to match the metabolic requirements of each species.

Studies have found no direct relation between the phylogeny of ATPase domains and the lifestyle or pathogenicity of Mycoplasma species, suggesting complex evolutionary dynamics in these transporters .

How can MPN_136 be targeted for antimicrobial development against Mycoplasma pneumoniae?

MPN_136 represents a potential target for novel antimicrobial strategies against M. pneumoniae due to several favorable characteristics:

  • Essential Function: As a component of ABC transporters involved in nutrient acquisition, MPN_136 likely plays an essential role in bacterial survival.

  • Surface Accessibility: As a membrane protein, portions of MPN_136 may be accessible to drugs without requiring cellular penetration.

  • Structural Uniqueness: Differences between bacterial and human ABC transporters can be exploited to achieve selective targeting.

Potential antimicrobial approaches include:

  • Small Molecule Inhibitors: Compounds that block the substrate-binding site or interfere with conformational changes during transport.

  • Peptide Inhibitors: Designed peptides that disrupt essential protein-protein interactions within the ABC transporter complex.

  • Antibody-Based Approaches: If portions of MPN_136 are surface-exposed, antibodies could be developed to inhibit transport function or mark cells for immune clearance.

Research has identified several ABC transporter proteins in Mycoplasma species that could serve as useful targets for the control of infections .

What CRISPR-based strategies can be employed to study MPN_136 function in Mycoplasma pneumoniae?

While genetic manipulation of Mycoplasma species has historically been challenging, CRISPR-Cas systems have opened new possibilities:

  • Gene Knockout: CRISPR-Cas9 can be adapted to create precise deletions or disruptions of the MPN_136 gene to study loss-of-function phenotypes.

  • CRISPRi: CRISPR interference using catalytically inactive Cas9 (dCas9) can be employed for gene repression without genome editing, allowing for tunable and reversible knockdown of MPN_136 expression.

  • Base Editing: CRISPR base editors can introduce specific point mutations to study structure-function relationships in MPN_136 without double-strand breaks.

  • Gene Tagging: CRISPR systems can facilitate the insertion of epitope tags or fluorescent proteins to track MPN_136 localization and dynamics.

Implementation requires optimization for the high AT content and unique genetic features of Mycoplasma genomes, but successful CRISPR-based manipulation would significantly advance the understanding of MPN_136 function in its native context.

How might single-molecule techniques advance our understanding of MPN_136 transport mechanisms?

Single-molecule approaches offer unprecedented insights into the dynamics and heterogeneity of membrane transport processes:

  • Single-Molecule FRET (smFRET): By labeling strategic sites in MPN_136 with FRET pairs, researchers can monitor conformational changes during the transport cycle in real-time.

  • Single-Molecule Force Spectroscopy: Techniques like atomic force microscopy (AFM) can measure the forces involved in substrate binding and translocation through MPN_136.

  • Total Internal Reflection Fluorescence (TIRF) Microscopy: This can be used to visualize individual transport events in reconstituted systems, providing insights into transport kinetics and heterogeneity.

  • Nanodiscs and Lipid Bilayer Electrophysiology: These approaches allow for electrical recording of individual transport events through single MPN_136-containing complexes.

These methods can reveal transient intermediates and rare events that are obscured in ensemble measurements, potentially resolving long-standing questions about the coupling mechanism between ATP hydrolysis and substrate translocation in ABC transporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.