Recombinant Mycoplasma pneumoniae Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant M. pneumoniae Lgt refers to the lab-engineered form of the prolipoprotein diacylglyceryl transferase enzyme, produced using heterologous expression systems. Lgt is responsible for the initial step in lipoprotein maturation: attaching a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in prolipoproteins .

In M. pneumoniae, lipoproteins are critical for host-pathogen interactions, immune evasion, and adhesion . Mature lipoproteins activate Toll-like receptors (TLRs), triggering inflammatory responses . Without Lgt-mediated modification, lipoproteins fail to anchor to membranes, impairing bacterial viability and virulence .

Key Properties

PropertyDetails
Gene LocusMPN_224 (UniProt: P75547)
Molecular Weight~43 kDa (predicted for 389-amino-acid sequence)
Expression SystemRecombinant protein produced in E. coli or similar hosts
Enzymatic ActivityDiacylglyceryl transfer to prolipoproteins; requires phosphatidylglycerol

Diagnostics

Recombinant Lgt is used in ELISA-based serodiagnostics to detect M. pneumoniae infections. Studies show recombinant antigens improve sensitivity over whole-cell assays .

Drug Development

  • Lgt inhibitors could disrupt lipoprotein maturation, bypassing resistance mechanisms seen in downstream targets (e.g., LspA) .

  • M. pneumoniae Lgt is conserved across strains, making it a stable target despite genomic recombination events .

Pathogenesis Studies

  • Lgt-deficient M. pneumoniae mutants would aid in studying lipoprotein-dependent immune activation (e.g., TLR2/4 signaling) .

  • Comparative studies with Listeria monocytogenes Lgt reveal lipoprotein roles in intracellular survival and nutrient uptake .

Challenges and Future Directions

  • Structural Studies: Cryo-EM or crystallography of M. pneumoniae Lgt could clarify substrate-binding mechanisms.

  • In Vivo Models: Testing Lgt inhibitors in animal models of M. pneumoniae pneumonia is needed to assess efficacy.

  • Cross-Species Relevance: Whether M. pneumoniae Lgt compensates for other lipoprotein modification defects (e.g., Lnt) remains unexplored .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly indicate your requirement in the order notes. We will strive to fulfill your request.
Lead Time
The delivery time can vary depending on the purchase method and location. For precise delivery timelines, please contact your local distributor.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us beforehand, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; MPN_224; MP607; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
lgt
Target Protein Sequence
MNPSVSSRPPWSTAFYLGPGFPIQWYGIIVAIGIAFGILMFVLKLIYFYKIQDNSFYFFI FIAVLTMVLGARAWYFLIEAVDGRSSGSNFFDFRNGGLAIQGGVLLTTLAGIIYFNVFLN MKTTKTKTTAKLLNNKNQIKTVYVERNISVFVMLDLIAPCVLIGQAIGRWGNFFNAEVYG AALVGSKNDTLSAANTTWGFLRILMPKVWDGMFINGSFRIPLFLIESFFNTIFFVFIYFV MDHIKGIRSGTIGFSYFLATGIVRLILETQRDEAFKYNTSIVFSALLILVGIVGIIYCQT LAIKLRGYFWTYFFLYGWYKVAAFFTTLFMKDRTQACSSKFAFYEKSLPEKERSFFQLKY YNDVLPPKIYRLYDHEMLMFDKLEAVPEA
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from Mycoplasma pneumoniae catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: mpn:MPN224

Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Lgt in Mycoplasma pneumoniae?

Lgt (prolipoprotein diacylglyceryl transferase) in M. pneumoniae catalyzes the first step in the post-translational modification of bacterial lipoproteins. This enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox motif of prolipoproteins via a thioether bond. The reaction results in the release of glycerol phosphate as a byproduct .

This modification is essential for proper anchoring of lipoproteins to the cell membrane. M. pneumoniae contains approximately 48 lipoproteins whose processing depends on Lgt activity . These lipoproteins serve critical functions including maintenance of cell envelope architecture, nutrient uptake, transport, adhesion, and virulence factors, making Lgt indispensable for bacterial survival and pathogenicity .

How does M. pneumoniae Lgt differ from Lgt in other bacterial species?

M. pneumoniae Lgt shares functional similarity with Lgt from other bacterial species but contains unique structural features. While the catalytic mechanism of diacylglyceryl transfer is conserved across bacteria, M. pneumoniae Lgt has evolved specific adaptations related to its minimal genome and parasitic lifestyle.

Compared to E. coli Lgt, which has been crystallized at 1.9 Å resolution in complex with phosphatidylglycerol and 1.6 Å with the inhibitor palmitic acid, M. pneumoniae Lgt likely maintains the core catalytic residues but may have variations in substrate binding regions . Unlike E. coli and other bacteria that possess a complete lipoprotein processing pathway (Lgt, Lsp, and Lnt), Mycoplasmas typically lack peptidoglycan and have adapted their lipoprotein processing machinery accordingly.

Comparative analysis suggests that M. pneumoniae lipoproteins processed by Lgt have unique immunogenic properties. Some M. pneumoniae lipoproteins (MPN162, MPN611) are specifically recognized by TLR1 and TLR2 heterodimers, suggesting they contain triacylated modifications, while others like the F₀F₁ ATP synthase subunit b (MPN602) are diacylated and activate TLR2 .

What experimental methods are used to express and purify recombinant M. pneumoniae Lgt?

Recombinant M. pneumoniae Lgt can be expressed and purified using methodologies similar to those established for other bacterial Lgt proteins, with specific adaptations for this membrane protein:

  • Expression system selection: E. coli BL21(DE3) strains with specialized vectors (pET or pBAD series) containing M. pneumoniae lgt gene optimized for E. coli codon usage.

  • Membrane protein extraction: Following bacterial cell disruption (sonication or French press), membrane fractions are isolated through differential centrifugation.

  • Detergent solubilization: Critical for membrane protein purification, typically using n-dodecyl-β-D-maltopyranoside (DDM), LDAO, or Triton X-100.

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography for increased purity

    • Ion exchange chromatography as needed

  • Protein validation: SDS-PAGE, western blotting, and mass spectrometry to confirm identity and purity.

The purified enzyme can be used in biochemical assays similar to those developed for E. coli Lgt, measuring glycerol phosphate release during the diacylglyceryl transfer reaction through coupled luciferase detection systems .

What is the substrate specificity of M. pneumoniae Lgt?

M. pneumoniae Lgt demonstrates substrate specificity on two levels:

Lipid substrate specificity:

  • Primary preference for phosphatidylglycerol as the diacylglyceryl donor

  • Can potentially utilize other phospholipids with lower efficiency

  • The structures of donor lipids can influence enzyme kinetics

Protein substrate specificity:

  • Recognizes prolipoproteins containing a lipobox motif ([LVI][ASTVI][GAS][C])

  • Absolutely requires the conserved cysteine residue at the +1 position relative to the signal peptide cleavage site

  • Mutation of this conserved cysteine to alanine (as in Pal-IAAA peptides) abolishes the reaction but creates a non-reactive substrate-based competitive inhibitor

Studies of Lgt activity demonstrate that substrate recognition depends on both the amino acid sequence surrounding the conserved cysteine and the hydrophobic properties of the signal peptide. M. pneumoniae Lgt likely processes approximately 48 different lipoproteins, each with slightly different lipobox motifs, suggesting a degree of flexibility in protein substrate recognition while maintaining strict requirements for the conserved cysteine residue .

How can the enzymatic activity of recombinant M. pneumoniae Lgt be measured?

Several methods can be employed to measure the enzymatic activity of recombinant M. pneumoniae Lgt:

  • Glycerol phosphate release assay: This coupled enzymatic assay detects the release of glycerol phosphate (either G1P or G3P depending on the phosphatidylglycerol substrate) during Lgt-catalyzed transfer of the diacylglyceryl moiety to a peptide substrate. Detection can be achieved through:

    • Luciferase-coupled bioluminescence detection system

    • Colorimetric phosphate detection methods

    • HPLC analysis of reaction products

  • Radiolabeled substrate incorporation: Using [³H] or [¹⁴C]-labeled phosphatidylglycerol to monitor diacylglyceryl transfer to peptide substrates.

  • Mass spectrometry analysis: LC-MS/MS to directly detect modified peptide products and quantify the conversion of prolipoproteins to lipoproteins.

  • In vitro reconstitution assays: Using synthetic peptides derived from known M. pneumoniae lipoproteins (like those from MPN602, MPN162, or MPN611) as substrates to measure modification rates.

A standardized assay might use a synthetic peptide substrate derived from a known M. pneumoniae lipoprotein containing the conserved cysteine residue (similar to the Pal-IAAC peptide used for E. coli Lgt) , phosphatidylglycerol as the lipid donor, and a coupled detection system for glycerol phosphate release.

What structural features of M. pneumoniae Lgt are critical for enzymatic function?

Based on structural studies of Lgt from other bacterial species (particularly E. coli), several critical structural features likely govern M. pneumoniae Lgt function:

Key catalytic residues:

  • Arginine residues (equivalent to E. coli Arg143 and Arg239) are essential for diacylglyceryl transfer and likely interact with the phosphate group of phosphatidylglycerol

  • Highly conserved histidine and glutamate residues involved in proton transfer during catalysis

  • Hydrophobic residues forming the binding pocket for the acyl chains of phosphatidylglycerol

Structural domains:

  • Transmembrane helices anchoring the enzyme in the bacterial membrane

  • Substrate binding cavities accessible laterally from the lipid bilayer

  • Periplasmic/extracellular loops involved in prolipoprotein recognition

The enzyme likely contains two binding sites: one for phosphatidylglycerol and another for the prolipoprotein substrate. Mutagenesis studies in E. coli have demonstrated that specific residues are critical for function, with complementation assays in lgt-knockout strains showing that mutations in the arginine residues completely abolish enzyme activity .

A hypothetical model of substrate and product movement suggests that both enter and leave the enzyme laterally relative to the lipid bilayer, consistent with the membrane-embedded nature of this transferase .

What approaches can be used to develop inhibitors of M. pneumoniae Lgt?

Several strategic approaches can be employed to develop effective inhibitors of M. pneumoniae Lgt:

Structure-based design:

  • Using homology models based on E. coli Lgt crystal structures

  • Virtual screening of compound libraries targeting the active site

  • Fragment-based drug discovery focusing on the phosphatidylglycerol binding pocket

Substrate-based inhibitors:

  • Modified peptides mimicking lipobox sequences but resistant to modification (similar to Pal-IAAA)

  • Phosphatidylglycerol analogs with modifications preventing transfer reactions

  • Competitive inhibitors occupying the diacylglyceryl binding site

High-throughput screening:

  • Biochemical assays measuring glycerol phosphate release to identify inhibitors

  • Whole-cell screening for compounds affecting lipoprotein processing

  • Reporter systems to monitor lipoprotein localization

Known inhibitors as starting points:

  • Compounds like G2824 and G9066, identified as inhibitors of E. coli Lgt with IC₅₀ values of 0.24 μM and 0.18 μM respectively

  • Palmitic acid derivatives, which have been co-crystallized with E. coli Lgt

Effective inhibitors would ideally show selectivity for bacterial Lgt over human enzymes, have appropriate pharmacokinetic properties for respiratory infections, and demonstrate efficacy against multi-drug resistant M. pneumoniae strains.

How can recombinant M. pneumoniae Lgt be used to develop serological assays for M. pneumoniae infections?

Recombinant M. pneumoniae Lgt can be leveraged for developing serological assays through several approaches:

Direct antibody detection:

  • Using purified recombinant Lgt as an antigenic target in ELISA or immunoblot assays

  • Developing Lgt-specific monoclonal antibodies for competitive immunoassays

Lipoproteome analysis:

  • In vitro lipoprotein modification system using recombinant Lgt to identify the complete set of M. pneumoniae lipoproteins

  • Selection of M. pneumoniae-specific lipoproteins with minimal cross-reactivity with other Mycoplasma species

Differential diagnostics:

  • Similar to approaches used for M. genitalium, focusing on M. pneumoniae-specific protein fragments to avoid cross-reactivity

  • Development of immunoblot assays based on recombinant fragments unique to M. pneumoniae

A major challenge in developing M. pneumoniae-specific serological tests is cross-reactivity with the closely related M. genitalium. Comparative studies have shown that finding specific antigens between related Mycoplasma species requires careful selection of targets with minimal sequence conservation .

A promising approach could involve using recombinant M. pneumoniae Lgt to generate Lgt-modified peptides representing M. pneumoniae-specific lipoproteins, then validating these as serological markers with appropriate sensitivity and specificity using samples from patients with PCR-confirmed M. pneumoniae infections.

What is the role of M. pneumoniae Lgt-processed lipoproteins in host immune response and inflammation?

M. pneumoniae lipoproteins processed by Lgt play crucial roles in triggering host immune responses and inflammation:

TLR activation pathways:

  • Diacylated lipoproteins (like MPN602, the F₀F₁ ATP synthase subunit b) induce inflammatory responses through TLR2

  • Some lipoproteins (MPN162, MPN611) are recognized by TLR1/TLR2 heterodimers, suggesting triacylated modifications

  • Activation of these pathways induces production of proinflammatory cytokines and chemokines

Inflammatory mediators induced:

  • IL-6, IL-8, TNF-α production by epithelial cells and macrophages

  • NF-κB pathway activation

  • MAPK signaling cascade stimulation

Contribution to disease pathogenesis:

  • Lipoproteins contribute to the characteristic "atypical pneumonia" inflammatory profile

  • Prolonged inflammation may contribute to extrapulmonary manifestations of M. pneumoniae infections

  • Individual variation in inflammatory responses to lipoproteins may explain differences in disease severity

The common N-terminal structure of M. pneumoniae lipoproteins serves as a pathogen-associated molecular pattern (PAMP) recognized by the innate immune system . The specific pattern of lipoprotein expression and processing by Lgt during different stages of infection may influence the intensity and character of the host inflammatory response.

Understanding these mechanisms has implications for therapeutic approaches targeting either the bacterial Lgt enzyme to prevent proper lipoprotein processing or the host inflammatory response to reduce immunopathology during M. pneumoniae infections.

How can complementation assays be designed to study M. pneumoniae Lgt mutants?

Complementation assays for studying M. pneumoniae Lgt mutants require careful experimental design due to the fastidious nature of this organism:

System design components:

  • Mutant generation:

    • Site-directed mutagenesis of conserved residues (homologous to E. coli Arg143, Arg239)

    • Construction of catalytically inactive variants

    • Domain swapping with Lgt from other species to identify specificity determinants

  • Expression vectors:

    • Shuttle vectors functional in both E. coli and M. pneumoniae

    • Inducible promoters for controlled expression

    • Epitope or fluorescent tags for tracking expression and localization

  • Delivery methods:

    • Transformation protocols optimized for M. pneumoniae

    • Transposon-based systems for stable integration

Complementation assessment:

  • Growth curve analysis comparing wild-type, mutant, and complemented strains

  • Lipoprotein processing efficiency measured by immunoblotting or mass spectrometry

  • Subcellular localization of lipoproteins using fractionation and immunoblotting

  • GFP-based in vitro assays similar to those used for E. coli Lgt

A particularly robust approach would combine genetic complementation with biochemical assays using purified proteins. For example, combinations of in vivo complementation followed by in vitro activity measurements can distinguish between problems with protein folding/stability versus catalytic activity.

Mutation typeExpected complementationExpected biochemical activityInterpretation
Catalytic residueNo rescueMinimal/no activityEssential for catalysis
Substrate bindingPartial rescueReduced affinityInvolved in substrate recognition
StructuralNo rescueProtein destabilizationRequired for proper folding
RegulatoryContext-dependentNormal in vitro activityInvolved in regulation not catalysis

What experimental approaches can determine the complete lipoproteome processed by M. pneumoniae Lgt?

Determining the complete lipoproteome processed by M. pneumoniae Lgt requires integrated experimental approaches:

Computational prediction:

  • Bioinformatic analysis of the M. pneumoniae genome for lipobox motifs ([LVI][ASTVI][GAS][C])

  • Prediction of signal peptides and lipidation sites using tools like LipoP, PRED-LIPO

  • Comparison with known lipoproteins from related Mycoplasma species

Proteomic approaches:

  • Metabolic labeling:

    • Incorporation of alkyne/azide-modified fatty acids into lipoproteins

    • Click chemistry for selective enrichment of lipidated proteins

    • LC-MS/MS identification of enriched proteins

  • Comparative proteomics:

    • Comparison of membrane proteomes between wild-type and Lgt inhibitor-treated bacteria

    • Triton X-114 phase separation to isolate amphipathic lipoproteins

    • Quantitative proteomics (SILAC, TMT) to measure changes in protein localization

  • Direct lipid modification detection:

    • Mass spectrometry analysis of N-terminal peptides for diacylglyceryl modifications

    • Site-specific detection of lipid attachment to conserved cysteine residues

Validation studies:

  • Construction of reporter fusions for predicted lipoproteins

  • Mutation of lipobox motifs to confirm Lgt-dependent processing

  • In vitro processing assays using recombinant Lgt and synthetic peptides

An optimal strategy would combine these approaches, starting with bioinformatic prediction (identifying ~48 potential lipoproteins in M. pneumoniae ), followed by experimental validation using complementary proteomic techniques, and final confirmation using targeted biochemical assays for selected candidates.

How can structural studies of M. pneumoniae Lgt be designed to overcome membrane protein crystallization challenges?

Structural studies of M. pneumoniae Lgt face significant challenges due to its nature as an integral membrane protein. Several methodological approaches can help overcome these obstacles:

Protein engineering strategies:

  • Construct optimization:

    • Truncation of flexible regions while preserving catalytic domains

    • Fusion with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Introduction of surface mutations to enhance crystal contacts

    • Thermostabilizing mutations to improve protein stability

  • Expression system selection:

    • E. coli strains optimized for membrane protein expression (C41/C43)

    • Insect cell or mammalian expression systems for improved folding

    • Cell-free expression systems with defined lipid environments

Crystallization approaches:

  • Lipidic environments:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization methods

    • Detergent screening to identify optimal solubilization conditions

  • Co-crystallization strategies:

    • With substrate analogs or inhibitors (similar to E. coli Lgt with palmitic acid )

    • With stabilizing antibody fragments or nanobodies

Alternative structural methods:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structure determination

    • Lipid nanodisc reconstitution to maintain native lipid environment

  • Integrated approaches:

    • NMR studies of specific domains or peptide interactions

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

    • Molecular dynamics simulations based on homology models

The successful structural determination of E. coli Lgt at 1.9 Å resolution provides a valuable template for designing M. pneumoniae Lgt structural studies. A strategic approach might begin with homology modeling based on the E. coli structure, followed by experimental validation of key predictions, and ultimately moving to direct structural determination using the most promising of the above methods.

What controls and validation steps are essential for developing M. pneumoniae Lgt inhibition assays?

Developing robust M. pneumoniae Lgt inhibition assays requires comprehensive controls and validation steps:

Essential controls for biochemical assays:

  • Enzyme activity controls:

    • Positive control: Fully active recombinant Lgt with optimal substrates

    • Negative controls:

      • Heat-inactivated enzyme

      • Reactions without enzyme

      • Reactions with catalytically inactive mutants (e.g., Arg→Ala)

  • Substrate controls:

    • Wild-type peptide substrates (containing lipobox with conserved cysteine)

    • Mutated peptides (C→A substitution) as non-reactive competitive inhibitors

    • Concentration-dependent substrate kinetics to establish Km values

  • Assay system controls:

    • Verification that potential inhibitors don't interfere with detection systems

    • Controls for background signal in the absence of enzymatic reaction

    • Solvent controls (DMSO, ethanol) at concentrations used for compound testing

  • Known inhibitor controls:

    • Positive control inhibitors (e.g., G2824, G9066 with established IC₅₀ values)

    • Non-specific lipid-binding compounds as negative controls

Validation approaches:

  • Orthogonal assay methods:

    • Secondary confirmation using alternative detection techniques

    • Mass spectrometry validation of inhibition effect on peptide modification

    • Membrane incorporation assays for lipoprotein localization

  • Selectivity profiling:

    • Testing against other enzymes in the lipoprotein processing pathway

    • Assessment of activity against human enzymes to evaluate safety

    • Activity against Lgt from other bacterial species to evaluate spectrum

  • Mode of inhibition studies:

    • Enzyme kinetics to determine competitive, non-competitive, or uncompetitive inhibition

    • Direct binding studies (thermal shift assays, surface plasmon resonance)

    • Crystallography or molecular modeling to confirm binding mode

The comprehensive controls used for E. coli Lgt inhibition assays provide a valuable template, particularly the verification that compounds like G9066 and G2824 do not inhibit the coupling reaction or contribute to background signal .

How can mouse models be developed to study the in vivo effects of M. pneumoniae Lgt inhibition?

Developing mouse models to study in vivo effects of M. pneumoniae Lgt inhibition requires careful consideration of infection dynamics and assessment methods:

Model development considerations:

  • Infection establishment:

    • Intranasal inoculation to mimic natural respiratory route

    • Standardized inoculum size of M. pneumoniae culture

    • Verification of colonization through bronchoalveolar lavage (BAL) PCR

    • Pre-treatment with Lgt inhibitors versus post-infection treatment

  • Mouse strain selection:

    • BALB/c mice (commonly used for respiratory infection models)

    • Immunocompromised models for persistent infection

    • Humanized mice expressing human TLRs for improved inflammatory response modeling

  • Treatment protocols:

    • Delivery routes: intranasal, intraperitoneal, or oral administration

    • Dosing schedule optimization

    • PK/PD studies to ensure adequate inhibitor concentrations at infection site

Outcome measurements:

  • Bacterial burden assessment:

    • Quantitative culture from lung tissue and BAL fluid

    • PCR-based quantification of bacterial load

    • Imaging techniques to visualize infection spread

  • Inflammatory response markers:

    • BAL fluid cytokine profile (IL-6, IL-8, TNF-α)

    • Histopathological examination of lung tissues

    • Flow cytometry analysis of inflammatory cell infiltration

  • Physiological parameters:

    • Body weight monitoring

    • Lung function tests

    • Oxygen saturation measurements

  • Molecular verification of Lgt inhibition:

    • Analysis of lipoprotein processing in recovered bacteria

    • Ex vivo activity assays with lung tissue homogenates

    • Comparison with Δlgt mutant phenotypes where available

Drawing on experience from S. pneumoniae Δlgt mutant studies , researchers should carefully monitor parameters affected by lipoprotein processing deficiency, including cation acquisition, growth in biological fluids, and resistance to oxidative stress. Comparative studies between chemical inhibition and genetic deletion models would provide valuable insights into the therapeutic potential of Lgt inhibitors.

How can recombinant M. pneumoniae Lgt be used in vaccine development strategies?

Recombinant M. pneumoniae Lgt offers several promising applications in vaccine development:

Antigen discovery and optimization:

  • Lipoproteome mapping:

    • Using recombinant Lgt to identify and characterize the complete set of M. pneumoniae lipoproteins

    • Screening for immunodominant lipoproteins as vaccine candidates

    • Identifying conserved lipoproteins across clinical isolates

  • Antigen engineering:

    • Production of recombinant lipoproteins with defined lipid modifications

    • Creation of chimeric lipoproteins combining multiple epitopes

    • Detoxified lipoprotein variants that maintain immunogenicity but reduce inflammatory responses

Adjuvant applications:

  • Immune response modulation:

    • Utilizing Lgt-processed lipoproteins as natural TLR2/TLR1 agonists

    • Controlling the degree of lipidation to fine-tune immune responses

    • Creating synthetic lipoprotein adjuvants with optimized properties

  • Delivery systems:

    • Lipoprotein-based nanoparticles for antigen delivery

    • Self-adjuvanting vaccine constructs incorporating Lgt recognition sequences

    • Multivalent vaccine platforms displaying multiple M. pneumoniae antigens

Practical implementation strategies:

  • In vitro processing system:

    • Utilizing recombinant Lgt for controlled lipidation of candidate antigens

    • Quality control of lipoprotein-based vaccine components

    • Standardization of lipoprotein modifications for consistent immunogenicity

  • Targeting strategies:

    • Rational design of Lgt inhibitors as potential therapeutic components

    • Combination vaccines targeting multiple virulence mechanisms

    • Reverse vaccinology approaches focusing on lipoproteome

The distinctive immunostimulatory properties of M. pneumoniae lipoproteins, particularly their interaction with TLR1/TLR2 , make Lgt-processed antigens promising candidates for vaccines that induce robust cell-mediated and humoral immune responses.

What are the challenges in scaling up production of recombinant M. pneumoniae Lgt for research applications?

Scaling up production of recombinant M. pneumoniae Lgt for research applications faces several technical challenges:

Expression system optimization:

  • Host selection considerations:

    • E. coli strains optimized for membrane protein expression (C41/C43, BL21(DE3)pLysS)

    • Alternative hosts (Bacillus, Pichia) for improved folding or reduced toxicity

    • Cell-free expression systems for difficult-to-express constructs

  • Vector design optimization:

    • Codon optimization for high-level expression

    • Fusion partners to enhance solubility (MBP, SUMO, thioredoxin)

    • Inducible vs. constitutive promoters for controlled expression

Membrane protein purification challenges:

  • Extraction optimization:

    • Detergent screening for efficient solubilization while maintaining activity

    • Evaluation of novel solubilization agents (SMALPs, nanodiscs, amphipols)

    • Development of detergent-free methods for native-like preparation

  • Purification strategy development:

    • Multi-step purification protocols to achieve research-grade purity

    • Scale-appropriate chromatography methods (IMAC, ion exchange, size exclusion)

    • Process optimization to minimize protein aggregation and denaturation

Activity preservation strategies:

  • Stability enhancement:

    • Buffer optimization for long-term storage

    • Lyophilization protocols for shipping and storage

    • Addition of stabilizing agents (glycerol, specific lipids)

  • Functional validation:

    • Development of high-throughput activity assays for batch validation

    • Thermal stability testing under various conditions

    • Validation of enzymatic parameters across production batches

Process development considerations:

  • Scale-up factors:

    • Bioreactor conditions optimization (oxygen transfer, mixing, temperature control)

    • Harvest timing optimization for maximum yield and activity

    • Development of continuous processing methods

  • Quality control metrics:

    • Purity assessment protocols (SDS-PAGE, SEC-MALS, mass spectrometry)

    • Endotoxin removal and testing procedures

    • Activity standardization across batches

Drawing from approaches used for E. coli Lgt production , a systematic optimization of expression conditions, detergent selection, and purification protocols will be essential for establishing reproducible large-scale production of active M. pneumoniae Lgt for research applications.

How does antimicrobial resistance affect the potential of M. pneumoniae Lgt as a drug target?

Antimicrobial resistance considerations significantly impact the potential of M. pneumoniae Lgt as a drug target:

Resistance landscape context:

  • Current M. pneumoniae resistance patterns:

    • Increasing macrolide resistance globally (>90% in some Asian countries)

    • Limited treatment options for resistant strains

    • Slow evolution of resistance due to reduced horizontal gene transfer

  • Target advantages of Lgt:

    • Essential enzyme with no human homolog

    • Highly conserved across bacterial species

    • Multiple lipoproteins dependent on Lgt function

Resistance development potential:

  • Genetic barriers to resistance:

    • Essential nature of Lgt function limits viable mutations

    • Conserved catalytic machinery constrains resistance-conferring changes

    • Multiple lipoproteins dependent on processing creates evolutionary pressure

  • Potential resistance mechanisms:

    • Target site mutations affecting inhibitor binding but preserving function

    • Upregulation of lgt gene expression

    • Alternative lipoprotein processing pathways (unlikely in minimal genome)

    • Efflux mechanisms limiting inhibitor concentration

Resistance mitigation strategies:

  • Drug design approaches:

    • Targeting highly conserved catalytic residues (equivalent to Arg143, Arg239)

    • Designing inhibitors that mimic transition states

    • Developing combination therapies targeting multiple steps in lipoprotein processing

  • Resistance monitoring:

    • Development of susceptibility testing methods for Lgt inhibitors

    • Genomic surveillance for lgt mutations in clinical isolates

    • Laboratory evolution studies to predict resistance mechanisms

  • Combination therapy potential:

    • Pairing with macrolides or tetracyclines

    • Combining with inhibitors of other essential processes

    • Targeting multiple steps in lipoprotein processing simultaneously

The essentiality of Lgt and its lack of human homologs makes it an attractive target despite resistance concerns. Evidence from Lgt inhibitor studies in E. coli suggests compounds like G2824 can inhibit bacterial growth , supporting Lgt as a viable antimicrobial target.

What are the key differences between in vitro and in vivo activity of M. pneumoniae Lgt that researchers should consider?

Researchers investigating M. pneumoniae Lgt must account for several critical differences between in vitro and in vivo activity:

Biochemical environment differences:

  • Lipid composition effects:

    • Artificial membrane systems in vitro vs. complex native membranes

    • Availability and composition of phosphatidylglycerol in different environments

    • Phase behavior and lateral organization of lipids affecting enzyme accessibility

  • Ionic conditions:

    • Controlled buffer systems in vitro vs. variable ionic conditions in vivo

    • Divalent cation availability affecting enzyme activity

    • pH gradients across membranes in living cells

  • Protein interactions:

    • Isolated enzyme in vitro vs. potential protein complexes in vivo

    • Competition for substrates with other membrane processes

    • Regulatory interactions absent in purified systems

Functional context differences:

  • Substrate availability:

    • Defined substrates in vitro vs. complex mixture of prolipoproteins in vivo

    • Temporal regulation of prolipoprotein expression during infection

    • Spatial organization of substrate delivery in cellular systems

  • Processing dynamics:

    • Static conditions in vitro vs. dynamic membrane environment in vivo

    • Coordination with other lipoprotein processing enzymes

    • Feedback regulation mechanisms present only in intact cells

  • Inhibitor efficacy factors:

    • Direct target access in vitro vs. membrane permeability barriers in vivo

    • Potential metabolic modification of inhibitors in living systems

    • Protein binding and distribution effects in biological fluids

Experimental design considerations:

  • Bridging studies:

    • Comparing enzymatic parameters between detergent-solubilized and membrane-reconstituted systems

    • Membrane vesicle assays as intermediate complexity models

    • Whole-cell activity assays monitoring lipoprotein processing

  • Physiological relevance markers:

    • Correlation between biochemical inhibition and growth effects

    • Monitoring multiple lipoprotein processing in parallel

    • Assessing impact on membrane integrity and stress responses

Studies of Lgt deletion in S. pneumoniae demonstrate that despite only minor growth defects in complete medium, Δlgt mutants show significant impairment in biological fluids and infection models , highlighting the importance of evaluating Lgt function and inhibition in physiologically relevant contexts.

How can cross-species comparisons of Lgt inform our understanding of M. pneumoniae Lgt function?

Cross-species comparisons of Lgt provide valuable insights into M. pneumoniae Lgt function:

Evolutionary conservation analysis:

  • Sequence conservation patterns:

    • Identification of absolutely conserved catalytic residues

    • Mapping species-specific variations to functional domains

    • Correlation between conservation and functional significance

  • Structural homology:

    • Comparison with E. coli Lgt crystal structure (1.9 Å resolution)

    • Mapping M. pneumoniae-specific residues onto structural models

    • Prediction of substrate binding sites based on conserved motifs

  • Phylogenetic relationships:

    • Clustering of Lgt proteins across bacterial phyla

    • Correlation with host range and pathogenicity

    • Identification of mycoplasma-specific adaptations

Functional comparison insights:

  • Substrate specificity differences:

    • Analysis of lipobox motif preferences across species

    • Comparison of phospholipid donor specificity

    • Cross-species activity assays with heterologous substrates

  • Essential nature evaluation:

    • Lethality of lgt deletion in most Gram-negative bacteria

    • Viability but reduced virulence in some Gram-positive bacteria

    • Prediction of essentiality in minimal genome organisms like M. pneumoniae

  • Processing pathway variations:

    • Comparison of complete lipoprotein processing pathways (Lgt, Lsp, Lnt)

    • Species-specific variations in processing order or requirements

    • Adaptations in organisms with simplified cell envelopes

Comparative inhibitor studies:

  • Inhibition profile comparison:

    • Cross-species activity of inhibitors like G2824 and G9066

    • Structure-activity relationships across bacterial species

    • Identification of species-selective inhibitor properties

  • Resistance mechanism comparison:

    • Natural variations in Lgt affecting inhibitor sensitivity

    • Cross-resistance patterns between species

    • Adaptation mechanisms in response to Lgt inhibition

The structural and mechanistic insights from E. coli Lgt studies , combined with functional observations from S. pneumoniae Δlgt mutants , provide a valuable framework for understanding M. pneumoniae Lgt. These comparisons can guide inhibitor design, predict functional importance of specific residues, and inform experimental approaches for studying this essential enzyme in the context of the minimalist M. pneumoniae cellular machinery.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.