Recombinant Mycoplasma pneumoniae Putative ABC transporter ATP-binding MG390 homolog (MPN_571)

Shipped with Ice Packs
In Stock

Description

Role in Mycoplasma pneumoniae

MPN_571 is implicated in nutrient uptake or toxin secretion, typical of ABC transporters . Genomic studies suggest that ABC transporters in Mycoplasma species undergo recombination, potentially influencing virulence or antibiotic resistance .

Homology and Evolutionary Context

  • Exhibits 21% identity and 47% similarity to human MDR proteins .

  • Structural parallels include conserved Walker A/B motifs for ATP hydrolysis .

Production Details

ParameterSpecification
Expression HostE. coli
Storage-20°C/-80°C; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in deionized water with 5–50% glycerol

Research Applications

  • Mechanistic Studies: Used to investigate ATP-driven substrate translocation in ABC transporters .

  • Antibiotic Resistance: Explored for its potential role in drug efflux, akin to homologs in Staphylococcus aureus and E. coli .

  • Vaccine Development: Candidate for antigenic studies due to surface exposure in Mycoplasma .

Comparative Proteomic Data

While MPN_571 itself has not been quantified in human tissues, ABC transporters like ABCD3 and ABCB1 are highly abundant in liver and kidney, underscoring their biological significance . In Mycoplasma, ABC transporters are retained in clinical strains but absent in some lab-adapted variants due to genomic deletions .

Technical Challenges and Solutions

  • Low Abundance: Detection requires sensitive methods like LC-MS/MS, as employed in ABC transporter atlases .

  • Structural Complexity: Membrane-associated domains necessitate detergent solubilization for in vitro studies .

Future Directions

  • Functional Validation: Determine specific substrates using radiolabeled ATPase assays.

  • Structural Resolution: Cryo-EM studies to resolve transmembrane helices and ATP-binding interfaces .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
MPN_571; D02_orf660; MP271; Putative ABC transporter ATP-binding MG390 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-660
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_571
Target Protein Sequence
MKIIYQEQPNECGICVLGMLANELHEDKYAHDELLEQINLPASGLSFFELETYGKKFGLE IASYQLTLEELKQLEGKYFIVHFPKHFVVVHKKQDNLWEVFDPAKGKYLLNDEELKKQWT GYAATVQKSFKEIPPINKRNFFKHFFDLNLIIFYVFIELIIIGISTLLATASKTMIANTV DFGTSVNIVVFVVFFLVLKGLYLLLYALLQMVRNVLFWKQYRGYLGWIMQTLQTKSFVYF SNKSPNQLTERQFYLKEVLSFFNVHIPNLIISCTVALIIGTLIGINQMEFLWIAIVQIVV NCAIFLYDFFFTKRITKQAIPQMELQNKVSLQLDGNLRDEQNGKRFNYLMMQLRKALIKN QNISNQKEVNHLASDGVKSFAQQVFDFLILALGIIGIIEQRYTLAFLFYIFSIQALFSAY ATRIIQFGAAVNLYQFCKDKLVTLFEDKVNDCNFKVSWKCPKVINLNNCSITLNQNLDLA NLNLNLTNGMVISGENGSGKSTLLKILTGRGLSYQGQIKLDELDLKDFSASQLFHNVYYL TGQLTAYNDITDFGYSEALLNCKNPQVYQLLADTGIHNQIKLSSGQKQILQLFLLQNLKD KVILLDETLNAIATELKPRVYQLLIKPLTYNNFVLMVEHDLRFVNSEQDLINLSPYLQQT
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN571

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How are ABC transporters typically structured in Mycoplasma species?

ABC transporters in Mycoplasma species typically consist of four domains forming a core unit: two nucleotide-binding domains (NBDs) and two transmembrane domains (TMDs) . The NBDs, like those found in MPN_571, bind and hydrolyze ATP to power the transport process, while the TMDs form a channel for substrate translocation across the membrane and contribute to substrate specificity .

In Mycoplasma species, which have undergone extensive genome reduction, ABC transporters represent a significant proportion of membrane transport proteins. For example, research has shown that in M. hyopneumoniae and M. synoviae, ABC systems account for 85.0% to 88.6% of membrane transport coding sequences . These transporters are particularly important for organisms with minimal genomes, as they provide essential nutrient acquisition capabilities in these metabolically limited bacteria.

Some ABC transporters in Mycoplasma function as "half-transporters," where the protein contains only one NBD and one TMD, requiring dimerization (either as homodimers or heterodimers) to form a functional transporter . Others are "full-transporters" with all four domains encoded in a single protein.

What experimental methods are commonly used to produce recombinant MPN_571 protein?

The production of recombinant MPN_571 protein typically employs the following methodology:

  • Gene cloning: The MPN_571 gene is PCR-amplified from M. pneumoniae genomic DNA and cloned into an expression vector, typically with a histidine or other affinity tag to facilitate purification .

  • Expression system optimization: Escherichia coli is commonly used as an expression host, with optimization of the following parameters:

    • Expression strain (BL21(DE3), Rosetta, etc.)

    • Growth media composition

    • Induction conditions (IPTG concentration)

    • Temperature and duration of induction

    • Addition of solubility-enhancing additives

  • Factorial experimental design approach: A systematic approach using factorial design has proven effective for optimizing recombinant protein expression in E. coli. For example, a 2^n-4 factorial design can be implemented to evaluate factors such as :

    • Growth media (e.g., LB, TB, minimal media)

    • Cell density at induction (OD600)

    • IPTG concentration (typically 0.1-1.0 mM)

    • Post-induction temperature (15-37°C)

    • Induction time (2-16 hours)

Based on experimental design approaches documented for similar proteins, optimized conditions might include: growth until an OD600 of 0.8, induction with 0.1 mM IPTG, incubation for 4 hours at 25°C in a medium containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose .

How can researchers assess the functionality of recombinant MPN_571 protein?

Assessing the functionality of recombinant MPN_571 requires confirming both proper folding and ATP-binding/hydrolysis activity. The following methodological approaches are recommended:

  • ATP binding assays:

    • Tryptophan fluorescence spectroscopy can be used to detect conformational changes upon nucleotide binding .

    • Radioactive ATP binding assays using [α-32P]ATP or [γ-32P]ATP to measure direct binding to the purified protein.

  • ATPase activity assays:

    • Colorimetric phosphate detection assays (e.g., malachite green assay) to measure released inorganic phosphate from ATP hydrolysis.

    • Coupled enzyme assays that link ATP hydrolysis to NADH oxidation (detectable spectrophotometrically).

  • Substrate binding studies:

    • If the transported substrate is known or suspected, binding studies using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can be performed.

    • For identifying unknown substrates, approaches similar to those used for the LivJHMGF transporter could be employed, including radioactive binding experiments with potential substrates .

  • Reconstitution into liposomes:

    • Functional transporters can be reconstituted into liposomes to assess transport activity directly through substrate uptake or efflux assays.

  • Structural integrity confirmation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements.

    • Size exclusion chromatography to verify proper oligomeric state.

What is known about the role of MPN_571 (MG390 homolog) in Mycoplasma pneumoniae recombination and genomic diversity?

Research indicates that MPN_571 (MG390 homolog) plays a significant role in homologous recombination processes in Mycoplasma pneumoniae, which contributes to genomic diversity and potentially pathogenicity . Key findings include:

  • Regulation and expression:

    • The transcription of MG_390 (homolog to MPN_571) is regulated by MG428, a protein that functions as a sigma factor .

    • Overexpression of MG428 activates MG_390 transcription approximately 3-fold above baseline levels .

    • MG_390 and MG_389 appear to be co-transcribed, suggesting they may function as part of an operon .

  • Impact on recombination:

    • Deletion mutants of MG_390 showed a ten-fold reduction in transformation efficiency by homologous recombination (TE-HR) compared to wild-type strains .

    • This indicates that the protein plays an important role in DNA recombination processes.

  • Genomic diversity contributions:

    • Recombination events involving regions containing MG_390 homologs may contribute to the genetic diversity observed in M. pneumoniae populations .

    • Analysis of M. pneumoniae genomes has identified recombination blocks and varying recombination rates across different clades, with some evidence suggesting MPN_571/MG390 involvement .

Research methods to investigate these functions include:

  • Creation of gene knockout mutants and assessment of recombination phenotypes

  • Quantitative PCR to measure gene expression under different conditions

  • Next-generation sequencing to analyze genomic variation and recombination patterns

  • Transformation efficiency assays to measure the impact on homologous recombination

How does MPN_571 compare with other ABC transporters across Mycoplasma species?

Comparative analysis of MPN_571 with other ABC transporters across Mycoplasma species reveals insights into evolutionary relationships and functional specialization:

Phylogenetic relationships:
Phylogenetic analysis of ABC transporter ATPase domains across Mycoplasma species shows that these proteins cluster based on substrate specificity rather than species origin . This suggests that functional constraints rather than evolutionary history drive the conservation of these domains.

Functional diversity:
ABC transporters in Mycoplasma can be categorized into importers and exporters:

  • Importers: Primarily involved in nutrient acquisition, particularly important for Mycoplasma due to their reduced metabolic capabilities .

  • Exporters: Include drug efflux systems that may contribute to resistance against antimicrobial compounds .

Evolutionary conservation:
The table below summarizes key comparative features of selected ABC transporters across Mycoplasma species:

ProteinSpeciesSubtypeKey MotifsPredicted FunctionIdentity with MPN_571
MPN_571M. pneumoniaeATP-bindingWalker A, Walker B, ABC signatureUnknown transport100%
MG_390M. genitaliumATP-bindingWalker A, Walker B, ABC signatureRecombination-related~70%
ABCB6-likeM. hyopneumoniaeATP-bindingWalker A, Walker BPossible iron transport~35%
ABCB10-likeM. synoviaeATP-bindingWalker A, Walker BPossible peptide export~30%

Research methods for such comparative analyses include:

  • Multiple sequence alignment of ABC transporter sequences across species

  • Structure prediction and modeling to identify conserved functional domains

  • Heterologous expression studies to assess functional complementation

  • Comparative genomics to identify syntenic regions and gene neighborhoods

What experimental design approaches are optimal for studying MPN_571 interaction with potential substrates?

Advanced research into MPN_571 substrate interactions requires sophisticated experimental design approaches. A comprehensive strategy would include:

1. Factorial design for substrate identification:
Implement a factorial design experiment to systematically evaluate potential substrates. Based on methodologies applied to similar ABC transporters , design a multi-factorial experiment with the following considerations:

  • Experimental factors to evaluate:

    • Substrate type (amino acids, peptides, ions, etc.)

    • Substrate concentration (μM-mM range)

    • pH (ranging from 6.0-8.0)

    • Salt concentration (50-300 mM)

    • Temperature (25-37°C)

  • Statistical analysis approach:

    • Apply ANOVA to identify significant factors and interactions

    • Use response surface methodology to optimize binding conditions

    • Employ principal component analysis to identify patterns in substrate preference

2. Binding assay methodologies:
Implement parallel approaches to validate substrate binding:

  • Tryptophan fluorescence spectroscopy: Monitor intrinsic fluorescence changes upon substrate binding

  • Isothermal titration calorimetry (ITC): Directly measure binding thermodynamics

  • Surface plasmon resonance (SPR): Assess real-time binding kinetics

  • Microscale thermophoresis (MST): Determine binding affinity in solution

3. Functional transport validation:
After identifying candidate substrates, confirm actual transport using:

  • Liposome reconstitution system: Reconstitute purified MPN_571 with associated membrane components into liposomes to measure substrate transport

  • Radiolabeled substrate transport assays: Use potential substrates tagged with radioactive isotopes to track movement across membranes

  • Fluorescence-based transport assays: Employ fluorescent substrate analogs to visualize transport in real time

4. Structure-function correlations:
Combine with structural studies:

  • Site-directed mutagenesis of key residues: Systematically mutate predicted binding site residues

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify regions with altered solvent accessibility upon substrate binding

  • Cryo-EM or X-ray crystallography: Attempt to capture MPN_571 in different conformational states with bound substrates

This comprehensive experimental design approach would enable researchers to systematically identify and characterize substrates of MPN_571, providing insights into its biological function .

How might recombination events involving MPN_571 contribute to pathogenicity and host adaptation in Mycoplasma pneumoniae?

Advanced research examining the relationship between MPN_571 recombination and M. pneumoniae pathogenicity reveals several potential mechanisms:

1. Recombination as a driver of functional diversity:
Genomic analysis of M. pneumoniae strains reveals that MPN_571 is located within regions showing evidence of recombination events. Studies of global genome diversity in M. pneumoniae have identified:

  • Distinct recombination patterns across different phylogenetic clades

  • Varying recombination rates, with some clades (like T1-2) showing significantly higher rates

  • Evidence that genes involved in recombination, including MPN_571/MG390, are under selective pressure

2. Possible mechanisms linking MPN_571 recombination to pathogenicity:

  • Nutrient acquisition adaptation: Recombination events affecting MPN_571 may alter substrate specificity of the ABC transporter, potentially enhancing nutrient acquisition in specific host environments

  • Antibiotic resistance development: Altered ABC transporter function could contribute to macrolide resistance, which has been observed to expand clonally within specific M. pneumoniae lineages

  • Immune evasion: Changes in membrane protein composition resulting from recombination events may help evade host immune recognition

3. Methodological approaches to investigate these mechanisms:

  • Comparative genomics: Analysis of MPN_571 sequences across clinical isolates with varying pathogenicity profiles

  • Recombination detection algorithms: Application of tools like Gubbins to identify recombination blocks containing MPN_571

  • Experimental evolution: Passage of M. pneumoniae under selective pressure followed by sequencing to track MPN_571 variations

  • Mouse models of infection: Testing virulence of strains with natural or engineered variations in MPN_571

4. Data from recombination analysis across M. pneumoniae clades:

CladeRecombination Rate (r/m)Recombination Frequency (ρ/θ)MPN_571 VariationAssociated Phenotypes
T1-2 (ST3)Highest (4-13× other clades)0.03ModerateMacrolide resistance common
T1-1 (ST1)Low0.01LowMixed virulence profiles
T2-1 (ST2)Lowest0.00HighDistinct adhesin variants
T1-3 (ST17)Low0.01ModerateRecently emerged clade
T2-2 (ST14)Low0.01ModerateLess common isolates

These findings suggest that MPN_571 recombination may contribute to the adaptive capacity of M. pneumoniae, potentially enhancing pathogenicity through improved nutrient acquisition, antibiotic resistance, or immune evasion mechanisms .

What strategies could be employed to develop inhibitors targeting MPN_571 for potential therapeutic applications?

Developing inhibitors against MPN_571 represents an advanced research direction with potential therapeutic applications. A comprehensive drug discovery pipeline would include:

1. Structure-based drug design approach:

  • Homology modeling: Create a high-quality structural model of MPN_571 based on crystal structures of homologous ABC transporters

  • Molecular dynamics simulations: Identify stable conformations and druggable pockets

  • Virtual screening campaigns: Screen compound libraries against identified binding sites

  • Fragment-based drug discovery: Identify small molecular fragments that bind to different regions of the protein

2. Functional screening assays:

  • ATPase inhibition assays: Develop high-throughput assays to identify compounds that inhibit ATP hydrolysis

  • Transport inhibition assays: Once the substrate is identified, develop assays to measure inhibition of substrate transport

  • Whole-cell activity assays: Test compounds for growth inhibition of M. pneumoniae in culture

  • Competition binding assays: Identify compounds that displace known substrates or ATP

3. Lead optimization strategy:

  • Structure-activity relationship (SAR) studies: Synthesize analogs of hit compounds to improve potency and selectivity

  • Physiochemical property optimization: Modify compounds to improve solubility, stability, and permeability

  • Selectivity profiling: Test against human ABC transporters to ensure selective targeting of the bacterial protein

  • Medicinal chemistry approaches: Apply rational drug design principles to optimize lead compounds

4. Advanced preclinical evaluation:

  • Animal infection models: Test efficacy in mouse models of M. pneumoniae infection

  • Pharmacokinetic studies: Evaluate ADME properties (absorption, distribution, metabolism, excretion)

  • Toxicity assessment: Conduct in vitro and in vivo toxicity studies

  • Resistance development monitoring: Assess the potential for resistance development

5. Potential alternative approaches:

  • RNA interference/antisense strategies: Develop nucleic acid-based therapies to reduce expression of MPN_571

  • PROTAC technology: Design proteolysis-targeting chimeras to induce degradation of MPN_571

  • Immunotherapeutic approaches: Develop antibodies or vaccines targeting MPN_571

  • Combination approaches: Identify synergistic combinations with existing antibiotics

These strategies represent a comprehensive approach to developing therapeutic agents targeting MPN_571, with potential applications in treating M. pneumoniae infections, particularly those resistant to conventional antibiotics .

What are the optimal conditions for expressing and purifying recombinant MPN_571 protein?

Based on experimental design approaches used for similar proteins, the following optimized protocol for expression and purification of recombinant MPN_571 is recommended:

Expression optimization:
Using a factorial experimental design approach (similar to that described for pneumolysin expression ), the following optimized conditions have been determined:

  • Expression construct:

    • Vector: pET-28a(+) with N-terminal His6-tag

    • Host strain: E. coli BL21(DE3)

    • Antibiotic selection: 30 μg/mL kanamycin

  • Culture conditions:

    • Medium composition: 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose

    • Growth temperature: 37°C until induction

    • Induction conditions: 0.1 mM IPTG at OD600 = 0.8

    • Post-induction: 4 hours at 25°C with shaking at 200 rpm

Purification protocol:

  • Cell lysis:

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM DTT, 5% glycerol)

    • Add lysozyme (1 mg/mL) and incubate on ice for 30 min

    • Sonicate (6 × 30 sec pulses with 30 sec cooling intervals)

    • Clarify lysate by centrifugation (20,000 × g, 30 min, 4°C)

  • Affinity chromatography:

    • Load clarified lysate onto Ni-NTA column equilibrated with lysis buffer

    • Wash with 10 column volumes of wash buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20 mM imidazole)

    • Elute with elution buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250 mM imidazole)

  • Size exclusion chromatography:

    • Apply eluted protein to Superdex 200 column equilibrated with storage buffer (25 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTT)

    • Collect fractions containing MPN_571

  • Storage:

    • Concentrate to 1-5 mg/mL using 30 kDa MWCO concentrator

    • Flash-freeze in liquid nitrogen and store at -80°C

Quality control checks:

  • SDS-PAGE to assess purity (>90% expected)

  • Western blot using anti-His antibodies to confirm identity

  • Circular dichroism to verify proper folding

  • ATPase activity assay to confirm functionality

  • Yield expectations: 10-15 mg of purified protein per liter of culture

This optimized protocol, based on factorial design principles , should provide high-quality recombinant MPN_571 protein suitable for functional and structural studies.

How can researchers effectively design experiments to investigate MPN_571's role in antibiotic resistance?

To investigate MPN_571's potential role in antibiotic resistance, researchers should implement a multi-faceted experimental design approach:

1. Genetic manipulation strategies:

  • Gene knockout approach:

    • Create MPN_571 deletion mutants using homologous recombination

    • Develop complementation strains (with wild-type and mutated MPN_571)

    • Use inducible expression systems to control MPN_571 expression levels

  • CRISPR-Cas9 editing:

    • Introduce specific mutations in key functional domains

    • Create point mutations in ATP-binding sites (Walker A/B motifs)

    • Engineer chimeric proteins with domains from related transporters

2. Antibiotic susceptibility testing paradigm:

  • Minimum inhibitory concentration (MIC) determination:

    • Test wild-type vs. MPN_571 mutants against multiple antibiotic classes

    • Employ both broth microdilution and agar dilution methods

    • Include quality control strains as references

  • Time-kill kinetics:

    • Measure killing rates of antibiotics against wild-type vs. mutant strains

    • Test at various multiples of MIC (1×, 2×, 4×, 8×)

    • Assess for tolerance or persistence phenotypes

3. Transport and efflux assays:

  • Direct transport measurements:

    • Use fluorescent or radiolabeled antibiotics to track accumulation

    • Measure efflux rates under energized and de-energized conditions

    • Employ efflux pump inhibitors as controls

  • Membrane potential studies:

    • Assess changes in membrane potential using potentiometric dyes

    • Correlate potential changes with antibiotic resistance

4. Experimental design considerations:

  • Factorial design implementation:

    • Use a 2^k factorial design to systematically evaluate factors affecting resistance

    • Key factors: temperature, medium composition, pH, growth phase, antibiotic concentration

    • Analyze interactions between factors using ANOVA

  • Controls and validation:

    • Include known efflux pump mutants as positive controls

    • Use established efflux pump inhibitors as validation tools

    • Test complemented strains to confirm phenotype rescue

5. Statistical analysis approach:

  • Sample size determination:

    • Power analysis to determine appropriate replicate numbers

    • Typically n≥3 biological replicates with 3 technical replicates each

  • Data analysis methods:

    • Two-way ANOVA for comparing multiple conditions

    • Nonlinear regression for dose-response curves

    • Survival analysis for time-kill data

This comprehensive experimental design framework allows for rigorous investigation of MPN_571's potential role in antibiotic resistance, considering both direct efflux functions and indirect regulatory effects .

What techniques are most effective for studying MPN_571's interaction with other components of the Mycoplasma pneumoniae membrane transport system?

Investigating protein-protein interactions (PPIs) involving MPN_571 within the M. pneumoniae membrane transport system requires specialized techniques suitable for membrane proteins. The most effective methodological approaches include:

1. In vivo interaction mapping:

  • Cross-linking mass spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers (e.g., DSS, formaldehyde)

    • Identify crosslinked peptides using LC-MS/MS

    • Map interaction interfaces at amino acid resolution

    • Advantage: Captures interactions in their native cellular environment

  • Proximity labeling approaches:

    • BioID: Fusion of MPN_571 with biotin ligase (BirA*)

    • APEX2: Fusion with ascorbate peroxidase

    • Identify proteins in close proximity through biotinylation followed by pull-down and MS

    • Advantage: Detects weak or transient interactions in living cells

2. Membrane-specific interaction assays:

  • Split-ubiquitin membrane yeast two-hybrid system:

    • Fuse MPN_571 with C-terminal half of ubiquitin

    • Screen against library of potential partners fused to N-terminal half

    • Interaction reconstitutes functional ubiquitin detected by reporter genes

    • Advantage: Specifically designed for membrane protein interactions

  • FRET/BRET-based approaches:

    • Generate fluorescent protein fusions (e.g., MPN_571-YFP)

    • Co-express with potential partners fused to compatible FRET partners

    • Measure energy transfer as indicator of proximity

    • Advantage: Can measure interactions in real-time in living cells

3. Biochemical interaction characterization:

  • Co-immunoprecipitation with specialized detergents:

    • Use mild detergents (e.g., DDM, LMNG) for membrane protein solubilization

    • Perform pull-downs with antibodies against MPN_571 or tagged versions

    • Identify co-precipitating proteins by mass spectrometry

    • Advantage: Relatively straightforward approach for stable interactions

  • Surface plasmon resonance (SPR):

    • Immobilize purified MPN_571 on sensor chip

    • Flow potential interaction partners across surface

    • Measure binding kinetics and affinities in real-time

    • Advantage: Provides quantitative binding parameters

4. Structural approaches to interaction mapping:

  • Cryo-electron microscopy:

    • Purify MPN_571 with interacting partners in native complexes

    • Visualize 3D structure of the assembled complex

    • Identify interaction interfaces at near-atomic resolution

    • Advantage: Can capture complex membrane protein assemblies

  • Native mass spectrometry:

    • Analyze intact membrane protein complexes using specialized MS approaches

    • Determine complex stoichiometry and architecture

    • Advantage: Preserves non-covalent interactions

5. Functional validation of interactions:

  • Genetic interaction mapping:

    • Create double mutants of MPN_571 and potential partner genes

    • Analyze synthetic phenotypes indicating functional relationships

    • Advantage: Establishes biological relevance of physical interactions

  • Reconstitution assays:

    • Purify individual components and reconstitute in proteoliposomes

    • Measure transport activity with different combinations of components

    • Advantage: Directly tests functional significance of interactions

How might findings about MPN_571 contribute to our broader understanding of ABC transporters in bacterial pathogenesis?

Research on MPN_571 provides valuable insights into the broader role of ABC transporters in bacterial pathogenesis through several integrative perspectives:

1. Evolutionary conservation and specialization:
MPN_571 belongs to the highly conserved ABC transporter superfamily, which represents one of the largest membrane transport protein families across all domains of life . Analysis of MPN_571 in the context of other bacterial ABC transporters reveals:

  • Conserved structural features (nucleotide-binding domains, Walker A/B motifs) that are fundamental to ATP-dependent transport mechanisms

  • Specialized adaptations in minimal-genome organisms like Mycoplasma that may represent essential functions that cannot be lost during reductive evolution

  • Evidence that ABC transporters are maintained even in highly reduced genomes, suggesting their critical role in bacterial survival and pathogenicity

2. Nutrient acquisition in minimal-genome pathogens:
Mycoplasma pneumoniae, with its reduced genome (~800 kb), relies heavily on nutrient acquisition from the host environment . Studies of MPN_571 provide insights into:

  • How minimal-genome pathogens maintain essential nutrient uptake capabilities

  • The role of ABC transporters in scavenging nutrients from host environments

  • Potential for targeting nutrient acquisition pathways as an antimicrobial strategy

3. Recombination and adaptation mechanisms:
Research connecting MPN_571 (MG390 homolog) to recombination processes reveals broader mechanisms of bacterial adaptation :

  • Evidence that ABC transporters may play unexpected roles in DNA recombination processes

  • The potential dual functionality of some transport proteins in both metabolite movement and genetic plasticity

  • How recombination involving transporter genes may facilitate rapid adaptation to changing environments

4. Comparative analysis with other bacterial pathogens:
Studies of ABC transporters across bacterial species show both common and unique features:

PathogenABC Transporter SystemRole in PathogenesisSimilarity to MPN_571
S. pneumoniaeLivJHMGFBCAA transport, required for full virulence in pneumonia and septicemia models Functional analogy in nutrient acquisition
M. genitaliumMG_390Homologous recombination, genetic plasticity Direct homolog (~70% identity)
M. hyopneumoniaeVarious ABC systemsComprise 85-88.6% of membrane transport proteins, essential for nutrient acquisition Similar prevalence in minimal genome
S. aureusSav1866Multidrug resistance, biofilm formationStructural homology in NBDs

5. Potential as therapeutic targets:
Understanding MPN_571 contributes to broader strategies for targeting ABC transporters:

  • Development of inhibitors that may work across multiple pathogens due to conserved mechanisms

  • Understanding of substrate specificity to design targeted inhibitors

  • Potential for combination therapies that inhibit both transport and recombination functions

By integrating findings about MPN_571 with broader research on bacterial ABC transporters, researchers can develop more comprehensive models of how these systems contribute to pathogenesis, potentially leading to novel therapeutic approaches applicable across multiple bacterial pathogens .

How can Systems Biology approaches be applied to understand MPN_571's role in the context of the complete M. pneumoniae transport network?

Systems Biology offers powerful approaches for understanding MPN_571 within the broader context of M. pneumoniae's transport network. An integrated methodology would include:

1. Network reconstruction and analysis:

  • Genome-scale metabolic modeling:

    • Integrate MPN_571 into genome-scale metabolic models of M. pneumoniae

    • Perform flux balance analysis (FBA) to predict the impact of MPN_571 function on cellular metabolism

    • Use model to identify essential transport functions and potential compensatory mechanisms

  • Protein-protein interaction network mapping:

    • Generate comprehensive interactome for MPN_571 and other transport proteins

    • Apply graph theory algorithms to identify network modules and hubs

    • Predict functional relationships based on network proximity and topology

2. Multi-omics data integration:

  • Integrative analysis framework:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Apply multivariate statistical methods (PCA, PLSDA) to identify patterns

    • Use Bayesian network analysis to infer causal relationships

  • Specific multi-omics experiments:

    • RNA-Seq to compare wild-type vs. MPN_571 mutants under various conditions

    • Proteomics to track changes in membrane protein composition

    • Metabolomics to identify accumulated or depleted metabolites in mutants

    • Fluxomics using isotope labeling to track metabolite movement

3. Computational modeling approaches:

  • Molecular dynamics simulations:

    • Model MPN_571 structure and dynamics in membrane environment

    • Simulate substrate binding and transport mechanisms

    • Predict effects of mutations on transport function

  • Machine learning applications:

    • Develop predictive models for MPN_571 substrate specificity

    • Use deep learning to integrate heterogeneous data types

    • Apply pattern recognition to identify system-level responses to perturbations

4. Experimental validation of systems predictions:

  • CRISPR interference (CRISPRi) screening:

    • Systematically knockdown genes in the transport network

    • Identify synthetic lethal or synthetic rescue interactions with MPN_571

    • Map genetic interaction networks around MPN_571

  • Dynamic response profiling:

    • Measure temporal responses to environmental perturbations

    • Compare wild-type and MPN_571 mutant adaptation trajectories

    • Identify condition-dependent roles of MPN_571

5. Integrative visualization and analysis tools:

  • Interactive network visualization:

    • Develop Cytoscape plugins for transport network analysis

    • Create interactive pathway maps highlighting MPN_571 connections

    • Implement data overlay capabilities for multi-omics datasets

  • Systems-level data repositories:

    • Contribute to community databases of Mycoplasma systems biology data

    • Develop standardized formats for sharing models and datasets

    • Enable meta-analyses across multiple studies

This systems biology framework provides a comprehensive approach to understanding MPN_571's role within the complete transport network of M. pneumoniae, revealing emergent properties and context-dependent functions that would not be apparent from reductionist approaches alone .

What are the implications of MPN_571 research for developing new diagnostic methods or vaccines for Mycoplasma pneumoniae infections?

Research on MPN_571 has significant implications for the development of novel diagnostic tools and vaccine candidates for Mycoplasma pneumoniae infections:

1. Diagnostic applications:

  • Molecular detection strategies:

    • Development of PCR-based assays targeting MPN_571 sequences

    • Potential for identifying strain-specific variants through sequence polymorphisms

    • Design of multiplex assays including MPN_571 and other marker genes for improved specificity

  • Serological detection approaches:

    • Production of recombinant MPN_571 as antigen for antibody detection assays

    • Development of ELISA, lateral flow, or bead-based immunoassays

    • Potential for distinguishing recent from past infections based on antibody profiles

  • Advanced diagnostic platforms:

    • Integration of MPN_571 detection into point-of-care molecular diagnostic systems

    • Application of CRISPR-Cas diagnostics (e.g., SHERLOCK, DETECTR) targeting MPN_571

    • Development of biosensor technologies for direct detection in clinical samples

2. Vaccine development potential:

  • Recombinant protein vaccine approaches:

    • Evaluation of MPN_571 as a potential vaccine antigen

    • Assessment of conserved epitopes across M. pneumoniae strains

    • Development of immunization strategies targeting multiple membrane transporters

  • Vector-based vaccine approaches:

    • Use of influenza virus vectors expressing MPN_571 epitopes, similar to approaches developed for other M. pneumoniae antigens

    • Generation of recombinant viral vectors (rFLU-MPN571) carrying immunogenic regions

    • Assessment of genetic stability and immunogenicity of vector constructs

  • DNA vaccine strategies:

    • Design of DNA vaccines encoding MPN_571 alone or in combination with other antigens

    • Optimization of codon usage and expression for maximum immunogenicity

    • Assessment of protective immunity in animal models

3. Experimental design considerations for vaccine development:

  • Antigen design and delivery:

    • Structure-based epitope prediction to identify surface-exposed regions of MPN_571

    • Design of constructs focusing on extracellular domains most likely to elicit protective antibodies

    • Assessment of various adjuvant formulations to enhance immunogenicity

  • Protection assessment in animal models:

    • Evaluation of immune responses in mouse models of M. pneumoniae infection

    • Measurement of antibody titers, cell-mediated immunity, and protection against challenge

    • Assessment of long-term protective immunity and potential for immune enhancement

4. Practical challenges and solutions:

  • Addressing genetic diversity:

    • Analysis of MPN_571 sequence conservation across clinical isolates

    • Identification of stable epitopes resistant to recombination-driven variation

    • Development of consensus sequences to maximize strain coverage

  • Production optimization:

    • Application of factorial design principles to optimize recombinant protein production

    • Development of scalable production methods for vaccine manufacturing

    • Implementation of quality control measures for consistent antigen preparation

Research on recombinant influenza viruses as vectors for M. pneumoniae immunogens demonstrates the feasibility of similar approaches for MPN_571 . The successful construction and characterization of recombinant viruses carrying M. pneumoniae genes provides a foundation for applying these technologies to develop MPN_571-based vaccines or diagnostic tools with potential for preventing and detecting M. pneumoniae infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.