Recombinant Mycoplasma pneumoniae Putative ABC transporter ATP-binding protein MG014 homolog (MPN_018)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Sequence

  • Gene Locus: MPN_018 (annotated in Mycoplasma pneumoniae strain M129) .

  • UniProt ID: P75095 .

  • Amino Acid Sequence: Comprises 623 residues, with a calculated molecular weight of 68.5 kDa . Key motifs include conserved Walker A/B ATP-binding domains and ABC signature sequences .

  • Post-Translational Modifications: Acetylation at lysine residue K576 has been reported .

Expression and Purification

  • Host System: Expressed in Escherichia coli with an N-terminal His-tag for purification .

  • Form: Lyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose .

  • Purity: >90% as confirmed by SDS-PAGE .

ParameterDetails
Expression SystemE. coli
TagN-terminal 10×His-tag
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

ABC Transporter Activity

ABC transporters utilize ATP hydrolysis to drive substrate translocation across membranes. MPN_018 is hypothesized to function in:

  • Drug Resistance: Homology to eukaryotic multidrug resistance (MDR) proteins suggests a role in antibiotic efflux .

  • Metabolite Transport: Potential involvement in nutrient uptake (e.g., phosphate, metals) critical for bacterial survival .

Pathogenicity and Host Interaction

  • Adhesion and Virulence: While not a primary adhesin like P1, MPN_018 may contribute to virulence by interacting with host immune components .

  • Immune Evasion: ABC transporters in Mycoplasma species degrade neutrophil extracellular traps (NETs), aiding immune evasion .

Antibiotic Resistance Studies

  • Macrolide-resistant M. pneumoniae strains (e.g., MRMp) often exhibit mutations in ABC transporters, altering drug-binding affinity .

  • Recombinant MPN_018 enables structural studies to map resistance mutations (e.g., 23S rRNA mutations) .

Clinical and Epidemiological Relevance

  • Outbreak Surveillance: Genomic recombination hotspots (e.g., MPN366–MPN371) near ABC transporter genes drive strain diversity and antibiotic resistance .

  • Diagnostic Targets: MPN_018’s immunogenicity makes it a candidate for serological assays, though less prominent than CARDS toxin .

Future Directions

  • Drug Development: Targeting MPN_018’s ATP-binding domains could inhibit bacterial efflux pumps, restoring macrolide efficacy .

  • Host-Pathogen Interactions: Elucidate its role in cytokine modulation (e.g., IL-6, TNF-α) during pneumonia .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
MPN_018; D12_orf623; MP136; Putative ABC transporter ATP-binding protein MG014 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-623
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_018
Target Protein Sequence
MGLVLKQFNRKIRTALILAPLFTFAQIIIDLIIPSFLASAIAVVFSIVTLKQKEASGEGV AVDFIAESKLSFQSVQEAQIVLATSVILLALFGLVFGLISIFCASIVAGNTSYFLRRKIF RKIMHITAPSHDQYGSSTLLVRLTNDVYLMEIMTFDFLRLIVRAPFLFIGGLAFAIATNS DMSISLAITFPLTFLVIGILNKKSTPLFKNNQKSVDQINERVEEDVSGYKVVQSFNLKDT ECLKFKAANARWTKSSTNSLFVNTLNIPFTFFFSSMTIIIALLLVFQLDNSVRVDPLPDN AAIRPSIFAFFQYNFYIVLGLILTSLTMVNFTRSRVALGRIKDVLNKPEIQQHVVPDQTV LAPSLEFKNVAFGLGNKENRDFLQDLNFKFEAGKTYGIVGPTGSGKSLIANIIGGLYEPN QGEIFVGGQSIKTIDSDYLAKMIGIVFQQNILFKGTIASNIKIGLETREDWKHEPDSKKD AAMKRAAAIACADTFIEKFSDTYDHTVEQLGKNLSGGQKQRVAIARTVITKPQILVLDDS MSALDALTEKKVRENIANELPGTTKIIISQNINSIKYAHKIMVIDNGRIAGFDSDAKLMQ SCDIYVKMKQAQKDQGGDFDAVA
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN018

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.