Recombinant Mycoplasma pneumoniae Putative ABC transporter ATP-binding protein MG015 homolog (MPN_019)

Shipped with Ice Packs
In Stock

Description

Introduction to MPN_019

Recombinant Mycoplasma pneumoniae Putative ABC Transporter ATP-Binding Protein MG015 Homolog (MPN_019) is a laboratory-produced version of an ATP-binding cassette (ABC) transporter component from M. pneumoniae. ABC transporters are ATP-dependent pumps critical for transporting substrates across cellular membranes, including nutrients, toxins, and signaling molecules. MPN_019 corresponds to the ATP-binding subunit of an ABC transporter, designated by the UniProt ID P75094 and gene name MPN_019 (synonyms: MG015 homolog, D12_orf634) .

Domain Architecture

MPN_019 belongs to the ABC transporter family, characterized by:

  • Nucleotide-Binding Domains (NBDs): Contain conserved Walker A/B motifs and the ABC signature motif for ATP binding/hydrolysis .

  • Transmembrane Domains (TMDs): Typically absent in ATP-binding subunits, as MPN_019 is exclusively an NBD component .

ABC transporters often form heterodimers (e.g., two NBDs paired with two TMDs) to function as efflux/influx pumps. MPN_019 likely interacts with TMD-containing partners to form a functional complex .

Sequence and Homology

  • Full-Length Sequence: 634 amino acids (1–634) with a His-tag for purification .

  • Homology: Shows similarity to eukaryotic multidrug resistance (MDR) proteins (up to 21% identity) and bacterial secretion proteins (e.g., E. coli HlyB) .

Production Overview

ParameterValueSource
OrganismMycoplasma pneumoniae (strain ATCC 29342 / M129)
Expression HostE. coli (full-length), Mammalian cells (partial)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Protein LengthFull-length (1–634 aa)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (lyophilized); 4°C for short-term aliquots

Reconstitute in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Functional Roles

MPN_019 is hypothesized to participate in:

  • Substrate Transport: Likely involved in nutrient uptake or toxin efflux, though specific substrates remain uncharacterized .

  • Pathogenesis: ABC transporters in M. pneumoniae may contribute to antibiotic resistance or immune evasion, though direct evidence for MPN_019 is lacking .

Experimental Uses

  • SDS-PAGE: Validates protein purity and size .

  • Structural/Functional Studies: Investigates ATP-binding kinetics or interactions with TMD partners .

Genetic Context

  • Gene Neighborhood: MPN_019 is adjacent to genes encoding surface adhesins and recombination elements (RepMP), which drive antigen variation in M. pneumoniae .

  • Recombination Events: RepMP sequences facilitate homologous recombination, potentially altering transporter function or substrate specificity .

Protein Interactions

MPN_019 may interact with:

  • TMD Partners: Hypothetical transmembrane subunits to form functional ABC transporters .

  • Regulatory Proteins: Modulators of ATP hydrolysis or substrate recognition .

Comparative Analysis with Other ABC Transporters

FeatureMPN_019Typical Bacterial ABC TransportersHuman ABC Transporters
Subunit TypeATP-binding (NBD)ATP-binding or transmembrane (TMD)ATP-binding or TMD
Substrate SpecificityUnconfirmedNutrients, antibiotics, toxinsCholesterol, lipids, drugs
Pathogenic RolePutative virulence factorEfflux pumps, nutrient acquisitionDrug resistance, disease
Expression SystemE. coli (recombinant)Native bacterial systemsNative human systems

MPN_019 shares structural homology with eukaryotic MDR proteins (e.g., P-glycoprotein) but lacks transmembrane domains, distinguishing it from full-length ABC transporters .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MPN_019; D12_orf634; MP135; Putative ABC transporter ATP-binding protein MG015 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-634
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_019
Target Protein Sequence
MLSSCRAVTSMSRWSKHKKTKEVISMLSHNQKPNSWKILWRLIKSVQGRTSSKVLYVMVC AIFGILTGVTNSILLAQGLGFIFPTTNTETDGIQSVYLLVFAHNLPVMERLTIVCVTVVV AYILIFSFNVAQNYLGLKLYQEICALLRWKAYLKIQSMSTSFFDTQNNGDLMSRLTNDVY NINNLYAQVGGQTIQSLFILMTTATILFVLSPVIALISLTVLIALIALSFLFLKKARAAY AKVQNNLGDMSGYIEEVLSNHKVVHVLKLQEVMIDNFDKYNRPMVNPTIKANTYAVFIYS WFGFISNITYLASISIATAFSVNNIPSFGVSAINYSFMLSYIAALRQTALPLNQIFSLWN LIQLGIVSGERVFKILDLESPQKQATITKLPNIKGNIRFEKVVFGYSADKPILTGIDFSV KHGDIVAIVGPTGAGKSTIINLLMKFYKPFAGKIYMDNFEISEVSETAWREKISIVLQDP FLFSGTIKENIRMGRQDATDEEIIEACKVANAHDFIMRLPQGYNTFISNKTDYLSVGERQ LLTIARAVIRNAPVLLLDEATSSIDVHSEKLIQQSIGRLMKDKTSFIISHRLSIIRNATL IIVINDGKVLEMGNHEQLMRQNGFYARLKRSAVK
Uniprot No.

Target Background

Database Links

KEGG: mpn:MPN019

Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the putative function of MPN_019 in Mycoplasma pneumoniae?

MPN_019, as a homolog of the MG015 ATP-binding protein, likely functions as a key component of an ABC transporter system in M. pneumoniae. ATP-binding cassette (ABC) transporters in bacteria play crucial roles in translocating various molecules across cell membranes. These transporters are involved in essential functions including nutrient absorption, toxic substance export, and potentially contributing to antimicrobial resistance mechanisms . In M. pneumoniae specifically, ABC transporters may facilitate the transport of sugars, amino acids, and other essential molecules required for bacterial survival and pathogenicity in the respiratory tract .

What is the general structure of ABC transporters in Mycoplasma species?

ABC transporters in Mycoplasma species, including those in M. pneumoniae, typically follow the core architecture found in other bacteria. This structure consists of two primary domains: transmembrane domains (TMDs) and nucleotide binding domains (NBDs) . The TMDs are composed of five to six α-helical segments that span the membrane and contain ligand binding sites. The amino acid sequences and topology of TMDs can vary between different types of ABC transporters .

The NBDs are highly conserved domains responsible for ATP binding and hydrolysis. They function as the "engine" of the transporter, adopting open or closed conformations by forming dimers. The transporter is inactive when NBD dimers separate, while ATPase activity occurs when the NBD dimer conformation is closed. These conformational changes drive the transport mechanism .

How does M. pneumoniae's unique biology affect ABC transporter function?

M. pneumoniae lacks a cell wall, which distinguishes it from many other bacteria and contributes to its natural resistance to antibiotics like penicillin that target cell wall synthesis . This unique cellular structure likely influences the membrane environment in which ABC transporters function. Without a cell wall, the ABC transporters are exposed directly to the external environment, which may affect their stability, substrate specificity, and regulation.

Additionally, M. pneumoniae has been characterized as genetically highly stable , which suggests that its ABC transporters, including MPN_019, may be well-conserved across different strains. This genetic stability could facilitate the development of broadly effective research tools and therapeutic approaches targeting these transporters.

What methods are used to express recombinant M. pneumoniae ABC transporters?

Expression of recombinant M. pneumoniae ABC transporters typically employs heterologous expression systems, with E. coli being the most common host. The methodological approach involves:

  • Gene cloning: The MPN_019 gene is amplified from M. pneumoniae genomic DNA using PCR with specific primers targeting the gene sequence.

  • Vector construction: The amplified gene is inserted into an expression vector containing appropriate promoters (such as T7), purification tags (like His-tag or GST), and selection markers.

  • Transformation and expression: The recombinant vector is transformed into an E. coli expression strain (BL21(DE3), Rosetta, or similar strains designed for membrane protein expression).

  • Induction: Protein expression is induced using IPTG or auto-induction systems, with optimization of temperature, induction time, and media composition to enhance soluble protein yield.

  • Purification: Membrane proteins like ABC transporters often require detergent solubilization followed by affinity chromatography and size exclusion chromatography to obtain pure protein.

Due to the challenging nature of membrane protein expression, researchers may need to explore alternative expression systems such as yeast (Pichia pastoris), insect cells, or cell-free systems when E. coli expression yields unsatisfactory results.

What structural analysis techniques are most effective for studying MPN_019?

For structural analysis of MPN_019, researchers should consider a multi-faceted approach:

  • X-ray crystallography: This remains the gold standard for determining high-resolution structures of ABC transporters, though crystallization of membrane proteins presents significant challenges. Success often requires extensive screening of detergents, lipids, and crystallization conditions.

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and may be particularly valuable for MPN_019. Cryo-EM allows visualization of the protein in a more native-like lipid environment and requires less protein than crystallography.

  • Nuclear Magnetic Resonance (NMR): Solution or solid-state NMR can provide valuable information about protein dynamics and ligand binding, especially for the soluble NBD domains.

  • Molecular dynamics simulations: Computational approaches complement experimental methods by modeling protein behavior in lipid bilayers and predicting conformational changes during the transport cycle.

  • Small-angle X-ray scattering (SAXS): This technique provides low-resolution structural information about protein shape and can be particularly useful for studying conformational changes in solution.

For the ATP-binding domains specifically, researchers should focus on characterizing the conserved motifs (Walker A, Walker B, signature motif) that are critical for nucleotide binding and hydrolysis through site-directed mutagenesis coupled with functional assays.

How can researchers overcome challenges in functional characterization of MPN_019?

Functional characterization of MPN_019 presents several challenges that researchers can address through specialized methodological approaches:

  • ATPase activity assays: Measuring ATP hydrolysis using colorimetric assays (malachite green) or radioisotope-based methods provides direct evidence of functional activity. To enhance specificity, researchers should:

    • Compare activity in various detergents and lipid environments

    • Include appropriate controls (Walker A mutant)

    • Correlate ATPase activity with transport function

  • Substrate identification: Unlike some well-characterized ABC transporters, the specific substrates of MPN_019 may be unknown. Approaches to identify substrates include:

    • Radioligand binding assays with potential substrates

    • Transport assays using reconstituted proteoliposomes

    • Comparative genomics to identify potential substrates based on homology with characterized transporters

    • Metabolic profiling of MPN_019 knockout mutants

  • Reconstitution systems: For direct transport measurements, MPN_019 should be reconstituted into:

    • Liposomes for traditional transport assays

    • Nanodiscs for single-molecule studies

    • Lipid bilayer systems for electrophysiology measurements

  • Coupling transport to ATPase activity: Researchers should establish the stoichiometry between ATP hydrolysis and substrate transport, which typically follows a 2:1 ratio (2 ATP molecules hydrolyzed per transport cycle).

What is known about the relationship between MPN_019 and drug resistance in M. pneumoniae?

While specific information about MPN_019's role in drug resistance is limited in the provided search results, research on related ABC transporters in Mycoplasma species provides valuable insights. In Mycoplasma hominis, the expression of two ABC transporter genes, md1 and md2, was significantly increased in ethidium bromide-resistant and ciprofloxacin-resistant strains compared to wild-type strains . This suggests that ABC transporters in Mycoplasma species can contribute to drug efflux mechanisms.

For MPN_019 specifically, researchers should consider:

  • Expression analysis: Quantitative RT-PCR to measure MPN_019 expression levels in drug-resistant M. pneumoniae strains compared to susceptible strains.

  • Gene knockout/knockdown studies: Creating MPN_019 deletion mutants to assess changes in drug susceptibility profiles.

  • Drug accumulation assays: Measuring intracellular accumulation of fluorescent antibiotics in the presence and absence of functional MPN_019.

  • Structural analysis of the substrate-binding pocket: Computational docking studies to predict potential interactions between MPN_019 and antimicrobial compounds.

The potential relationship between MPN_019 and drug resistance is particularly significant given that M. pneumoniae naturally lacks a cell wall, making it intrinsically resistant to beta-lactam antibiotics . Additional resistance mechanisms mediated by ABC transporters would further limit treatment options.

How does MPN_019 compare structurally and functionally to homologous proteins in other Mycoplasma species?

Comparative analysis of MPN_019 with homologous proteins in other Mycoplasma species reveals important evolutionary and functional relationships. The closest homolog appears to be the MG015 protein from Mycoplasma genitalium, which shares significant sequence similarity .

Based on the analysis of other ABC transporters in Mycoplasma species, we can construct the following comparison table:

SpeciesProteinFunctionSequence Identity to MPN_019Special Features
M. genitaliumMG015Putative MDR ABC transporterHigh (estimated >70%)Adjacent to MG014, forming a potential heterodimeric transporter
M. pneumoniaeMsbAMDR-like transporterModerateForms functional pair with pmd1
M. hominismd1/md2Multidrug resistanceLow-ModerateExpression increases in drug-resistant strains

For comprehensive structural comparison, researchers should:

  • Perform detailed sequence alignments focusing on conserved motifs in the NBD domains

  • Analyze the TMD regions for substrate specificity determinants

  • Compare expression patterns and genomic context across species

  • Assess functional conservation through complementation studies

Understanding these relationships can provide insights into the evolution of transport functions in minimal genomes and guide the development of broad-spectrum inhibitors targeting conserved features of these transporters.

What experimental approaches can identify interaction partners of MPN_019?

Identifying protein-protein interactions (PPIs) for MPN_019 is crucial for understanding its biological context and regulatory mechanisms. Recommended experimental approaches include:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged MPN_019 to pull down interaction partners from M. pneumoniae lysates, followed by mass spectrometry identification.

  • Bacterial two-hybrid (B2H) or yeast two-hybrid (Y2H) screening: For systematic screening of potential interaction partners, especially for the soluble domains of MPN_019.

  • Proximity-based labeling: Techniques such as BioID or APEX2, where MPN_019 is fused to a proximity labeling enzyme to tag nearby proteins in living cells.

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linking followed by MS analysis to identify proteins in close physical proximity to MPN_019.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): For validating and quantifying specific interactions with candidate partners.

  • Split-GFP complementation assays: To visualize interactions in living cells and determine subcellular localization of interaction complexes.

Potential interaction partners to investigate include:

  • Other components of the ABC transporter complex

  • Regulatory proteins that modulate transport activity

  • Membrane proteins involved in substrate recognition

  • Cytoskeletal elements that might anchor the transporter complex

  • Proteins involved in energy metabolism that might couple ATP production to transport activity

How can researchers effectively study the role of MPN_019 in M. pneumoniae pathogenesis?

Investigating the role of MPN_019 in M. pneumoniae pathogenesis requires approaches that bridge molecular function with bacterial virulence mechanisms. Key methodological strategies include:

  • Gene knockout/knockdown studies:

    • Generate MPN_019 deletion or conditional mutants

    • Assess changes in growth, metabolism, and virulence-associated phenotypes

    • Evaluate survival under stress conditions that mimic the host environment

  • Infection models:

    • Human respiratory epithelial cell culture models

    • Air-liquid interface cultures to mimic respiratory tract conditions

    • Small animal models (if available and appropriate)

    • Monitor bacterial adherence, cytopathic effects, and host immune responses

  • Transcriptomics/proteomics:

    • Compare gene/protein expression profiles between wild-type and MPN_019 mutants

    • Identify compensatory mechanisms or downstream effects

    • Analyze expression changes under different growth conditions or during infection

  • Functional transport assays:

    • Identify specific substrates transported by MPN_019

    • Determine if these substrates contribute to virulence (e.g., nutrient acquisition, toxin export)

    • Assess the impact of transport inhibition on bacterial fitness

What protein purification strategies yield the highest quality recombinant MPN_019?

Purification of membrane proteins like MPN_019 requires specialized approaches to maintain protein stability and functionality. A recommended purification workflow includes:

  • Membrane isolation and solubilization:

    • Lyse cells expressing MPN_019 using mechanical methods (sonication, French press)

    • Isolate membrane fraction through ultracentrifugation

    • Solubilize using mild detergents (DDM, LMNG, or GDN)

    • Screen multiple detergents to identify optimal conditions

  • Affinity chromatography:

    • Use His-tag, FLAG-tag, or other affinity tags for initial capture

    • Include ATP/Mg²⁺ in buffers to stabilize the NBD domain

    • Optimize imidazole concentration to minimize non-specific binding while maximizing yield

  • Size exclusion chromatography:

    • Remove aggregates and assess oligomeric state

    • Buffer optimization to maintain stability

    • Consider including lipids (cholesterol, specific phospholipids) to mimic native membrane environment

  • Quality assessment:

    • SDS-PAGE and Western blotting for purity and identity

    • Circular dichroism to verify secondary structure

    • ATPase activity assays to confirm functionality

    • Thermostability assays (differential scanning fluorimetry) to optimize buffer conditions

For researchers requiring the most native-like preparation, consider:

  • Extraction using styrene maleic acid lipid particles (SMALPs)

  • Reconstitution into nanodiscs with defined lipid composition

  • Amphipol stabilization for structural studies

What are the most sensitive methods for detecting MPN_019 ATPase activity?

Several assay methods can be employed to detect and quantify the ATPase activity of purified MPN_019, each with specific advantages:

  • Colorimetric phosphate detection:

    • Malachite green assay: Detects inorganic phosphate released during ATP hydrolysis

    • Molybdate-based assays: Similar principle with different detection chemistry

    • Sensitivity: Can detect nanomolar ranges of phosphate

    • Advantages: Simple, cost-effective, amenable to high-throughput screening

    • Limitations: Potential interference from buffer components

  • Coupled enzyme assays:

    • ATP regeneration systems (pyruvate kinase/lactate dehydrogenase)

    • NADH oxidation monitored at 340 nm

    • Advantages: Continuous real-time monitoring, less prone to product inhibition

    • Limitations: Multiple enzyme components can complicate interpretation

  • Radioisotope-based assays:

    • Using [γ-³²P]ATP or [γ-³³P]ATP

    • Measure released radiolabeled phosphate

    • Advantages: Highest sensitivity, direct measurement

    • Limitations: Requires radioactive materials handling protocols

  • Bioluminescence-based ATP detection:

    • Luciferase-based detection of remaining ATP

    • Advantages: Extremely sensitive, commercially available kits

    • Limitations: Endpoint assay, potential luciferase inhibition by assay components

For optimal results, researchers should:

  • Include appropriate controls (ATPase inhibitors, catalytically inactive mutants)

  • Determine enzyme kinetics parameters (Km, Vmax)

  • Test activity modulation by potential substrates and inhibitors

  • Evaluate the effect of lipid environment on activity

How can researchers effectively model the structure of MPN_019 when experimental data is limited?

When experimental structural data for MPN_019 is limited, computational approaches provide valuable insights:

  • Homology modeling:

    • Identify suitable templates through sequence alignment (other bacterial ABC transporters with solved structures)

    • Specialized membrane protein modeling servers (e.g., SWISS-MODEL, I-TASSER, AlphaFold2)

    • Refinement with molecular dynamics simulations in a lipid bilayer environment

  • Template selection strategy:

    • Use multiple templates for different domains (NBD and TMD separately)

    • Consider different conformational states (ATP-bound, nucleotide-free)

    • Prioritize templates with highest sequence identity in conserved regions

  • Model validation:

    • Energy minimization and stability assessment

    • Ramachandran plot analysis

    • Conservation mapping to verify that conserved residues align with functional sites

    • Comparison with experimental data from related proteins

  • Functional annotation:

    • Identify ATP-binding motifs (Walker A, Walker B, signature motif)

    • Predict substrate-binding regions in the TMDs

    • Map potential interaction surfaces for partner proteins

  • Advanced modeling approaches:

    • Molecular dynamics simulations to assess conformational changes

    • Ligand docking to predict substrate and inhibitor binding

    • Coarse-grained simulations to study large-scale movements during the transport cycle

These computational models can guide experimental design, including site-directed mutagenesis targets and the development of functional assays specific to predicted mechanisms.

What experimental controls are essential when studying MPN_019 function?

Rigorous experimental controls are critical for reliable characterization of MPN_019 function:

  • Negative controls:

    • Catalytically inactive mutants (Walker A lysine to alanine substitution)

    • Empty vector expressions processed identically to MPN_019 samples

    • Heat-inactivated protein samples

    • Detergent-only controls for membrane protein assays

  • Positive controls:

    • Well-characterized ABC transporters with similar functions

    • Commercial ATPase enzymes for activity assay validation

    • Known substrates of related transporters

  • Specificity controls:

    • ATP analogs (non-hydrolyzable) to confirm ATP dependence

    • Vanadate or other ATPase inhibitors to confirm specific activity

    • Competition assays with unlabeled substrates

  • System controls:

    • Verification of correct membrane insertion and topology

    • Quality control for protein folding and oligomeric state

    • Lipid composition controls when using reconstituted systems

  • Data validation:

    • Technical and biological replicates

    • Multiple, orthogonal methods to confirm key findings

    • Dose-response relationships for substrates and inhibitors

Implementing these controls ensures that observed effects are specifically attributable to MPN_019 activity rather than experimental artifacts or contaminating activities.

How might MPN_019 serve as a target for novel antimicrobial strategies?

MPN_019, as an essential ABC transporter, represents a potential target for novel antimicrobial strategies against M. pneumoniae. Several approaches warrant exploration:

  • Direct inhibition strategies:

    • ATP-competitive inhibitors targeting the NBD domain

    • Allosteric inhibitors that prevent conformational changes required for transport

    • Substrate mimics that compete for binding but are not transported

    • Molecules that destabilize the NBD dimer interface

  • Target validation approaches:

    • Conditional knockout studies to confirm essentiality

    • Fitness studies under different growth conditions

    • Combinatorial effects with existing antibiotics

  • Screening methodologies:

    • High-throughput ATPase inhibition assays

    • Growth inhibition assays with M. pneumoniae

    • Structure-based virtual screening using computational models

    • Fragment-based drug discovery targeting specific binding pockets

  • Selectivity considerations:

    • Structural comparison with human ABC transporters to identify unique features

    • Focus on mycoplasma-specific structural elements or regulation mechanisms

    • Consider species-specific substrate binding sites

The lack of a cell wall in M. pneumoniae makes ABC transporters particularly accessible targets, potentially allowing for easier drug delivery to the target site compared to wall-containing bacteria where penetration can be a significant challenge.

What are the implications of MPN_019 research for understanding minimal cellular systems?

M. pneumoniae is recognized for having one of the smallest genomes among self-replicating organisms, making it an important model for understanding minimal cellular systems. Research on MPN_019 contributes to this understanding in several ways:

  • Essential transport processes:

    • Defining the minimum set of transporters required for cellular viability

    • Understanding how transport functions are prioritized in minimal genomes

    • Identifying whether MPN_019 has evolved to handle multiple substrates due to genomic reduction

  • Evolutionary implications:

    • Comparative analysis with homologs in other minimal genome organisms

    • Assessment of selective pressures on transport functions during genome reduction

    • Identification of core vs. accessory features of ABC transporters

  • Systems biology integration:

    • Mapping MPN_019 function within the metabolic network of M. pneumoniae

    • Understanding how transport activities are coordinated with cellular energy status

    • Identifying regulatory mechanisms that persist even in minimal systems

  • Synthetic biology applications:

    • Defining essential transport components for minimal cell design

    • Engineering optimized transport systems for synthetic biology applications

    • Understanding the minimal requirements for membrane organization and function

The highly stable genome of M. pneumoniae suggests that its ABC transporters, including MPN_019, have undergone substantial evolutionary optimization, retaining only the most essential functions and structural elements.

How can structural information about MPN_019 advance ABC transporter research more broadly?

Structural insights about MPN_019 can significantly advance broader ABC transporter research:

  • Evolutionary insights:

    • MPN_019 represents ABC transporters in a minimal genome, potentially revealing core structural elements conserved across diverse ABC transporters

    • Comparison with homologs from organisms with larger genomes can identify essential vs. auxiliary structural features

  • Mechanistic understanding:

    • Structural studies of MPN_019 can provide insights into the basic coupling mechanism between ATP hydrolysis and substrate transport

    • The smaller genome context may offer a simplified system to study fundamental ABC transporter principles

  • Structure-function relationships:

    • Identification of residues critical for substrate specificity

    • Understanding the structural basis of ATP binding and hydrolysis in a minimal system

    • Elucidating conformational changes during the transport cycle

  • Therapeutic applications:

    • Novel binding sites or conformational states that could be exploited for inhibitor design

    • Structural features that distinguish bacterial from human ABC transporters

    • Potential for structure-based design of broad-spectrum inhibitors targeting conserved features

  • Methodological advances:

    • Development of improved approaches for membrane protein expression and purification

    • Novel methods for functional characterization of difficult-to-study transporters

    • Innovative structural biology techniques applicable to other membrane proteins

The unique characteristics of Mycoplasma pneumoniae, including its minimal genome and lack of cell wall , position MPN_019 as a valuable model system for fundamental ABC transporter research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.