Recombinant Mycoplasma pneumoniae Putative phosphotransferase enzyme IIB component MPN_268 (MPN_268)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mycoplasma pneumoniae

  • Enzymatic Activity: While MPN_268 is classified as a putative PTS enzyme IIB, experimental evidence suggests it lacks glycerophosphodiesterase activity. In M. pneumoniae, MPN566 (a homolog) was found inactive in cleaving glycerophosphodiesters, unlike GlpQ (MPN420), which is essential for glycerol-3-phosphate metabolism .

  • Pathogenicity Link: The PTS system in M. pneumoniae intersects with glycerol metabolism, a process linked to hydrogen peroxide production—a key virulence factor causing host cell damage . Though MPN_268’s direct role in cytotoxicity remains unconfirmed, its genomic proximity to metabolic pathways suggests indirect involvement .

Research Applications

Recombinant MPN_268 is primarily used in:

  • Antigen Production: Serves as a target for antibody development due to its surface accessibility in M. pneumoniae .

  • Host-Pathogen Interaction Studies: Potential involvement in adhesion or immune evasion mechanisms, though specific binding partners are yet to be identified .

  • Enzyme Characterization: Structural studies to resolve its catalytic mechanism, given conflicting annotations about its activity .

Unresolved Questions and Research Gaps

  • Catalytic Function: Despite its classification, MPN_268’s enzymatic activity remains unverified. Structural modeling or kinetic assays are needed to clarify its role in the PTS .

  • Pathogenic Contribution: No direct evidence links MPN_268 to virulence, unlike GlpQ or GlpD, which are essential for hydrogen peroxide production and cytotoxicity .

  • Host Interactions: Preliminary proteomic studies highlight its presence in M. pneumoniae surface fractions, but interactions with host proteins (e.g., immune receptors) are unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MPN_268; A65_orf117; MP565; Putative phosphotransferase enzyme IIB component MPN_268; Putative PTS system EIIB component
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Target Names
MPN_268
Target Protein Sequence
MKVLLWIGYVLSFGLLYLYLVKRAKRAALQLNNKLVESHTIPFAVRDFIAACGGRTNFVSLRTSPTQLIVSFAKPELVQIAALQKLGIKGINKSQNQYRFVLGNFVNQLKQQIENER
Uniprot No.

Target Background

Function
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates while simultaneously translocating them across the cell membrane.
Database Links

KEGG: mpn:MPN268

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is MPN_268 and what is its primary function in Mycoplasma pneumoniae?

MPN_268 is a putative phosphotransferase enzyme IIB component from Mycoplasma pneumoniae, comprising 117 amino acids in its full-length form . It functions as a critical component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), which is a major carbohydrate active transport system in bacteria . This system plays an essential role in bacterial metabolism by catalyzing the phosphorylation of incoming sugar substrates while simultaneously translocating them across the cell membrane . As an IIBC subunit, MPN_268 likely participates in both the membrane-spanning transport function (C domain) and the cytoplasmic phosphoryl transfer process (B domain), making it integral to M. pneumoniae's ability to uptake and process specific carbohydrates.

How was MPN_268 initially identified and annotated in the M. pneumoniae genome?

MPN_268 was identified through genomic sequencing and annotation of the Mycoplasma pneumoniae strain M129 genome. The genome of M. pneumoniae has been annotated multiple times, with the most recent comprehensive annotation occurring in 2000 . Subsequent proteogenomic mapping studies validated the existence of this predicted open reading frame (ORF) by directly observing its expressed peptides via mass spectrometry . This approach is particularly valuable for confirming genomic annotations, as it provides direct evidence of protein expression rather than relying solely on computational predictions. The proteogenomic mapping detected over 81% of genomically predicted ORFs in M. pneumoniae, including MPN_268, confirming its expression and lending credibility to its annotation .

What expression systems are most effective for recombinant production of MPN_268?

For recombinant production of MPN_268, Escherichia coli has been established as an effective heterologous expression system . The protein can be successfully expressed as a His-tagged recombinant protein in E. coli, enabling purification through affinity chromatography techniques . When expressing MPN_268, optimal growth conditions for the bacterial culture include:

  • Temperature: 37°C

  • Agitation: Shaking at 300 rpm

  • Selection: Ampicillin resistance

For cloning purposes, the GoldenGate assembly method using BsaI restriction enzyme has proven effective, with the following specific overhangs:

  • 3' - AATG ... GCTT - 5'

The plasmid construct pOpen-MPN268 (2416 bp total size) with an insert size of 354 bp has been successfully used for this purpose, leveraging a high-copy ColE1 origin of replication (500-700 copies per cell) .

What purification strategies yield the highest purity and activity of recombinant MPN_268?

While specific purification protocols for MPN_268 are not detailed in the provided sources, standard approaches for His-tagged bacterial proteins can be adapted. A methodologically sound purification protocol would typically include:

  • Cell lysis using sonication or mechanical disruption in a buffer containing 25 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10 mM imidazole

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Sequential washing with increasing imidazole concentrations (20-50 mM)

  • Elution with high imidazole buffer (250-500 mM)

  • Size exclusion chromatography for final polishing and buffer exchange

For specific activity assessments of the purified protein, researchers should develop phosphotransferase activity assays using appropriate sugar substrates based on the predicted specificity of MPN_268.

What experimental approaches can reveal the structure-function relationship of MPN_268?

Several complementary experimental approaches can elucidate the structure-function relationship of MPN_268:

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

  • Site-directed mutagenesis of conserved residues, particularly those in the predicted active site

  • Isothermal titration calorimetry (ITC) to measure binding affinity with potential sugar substrates

  • Circular dichroism (CD) spectroscopy to assess secondary structure content and thermal stability

  • Nuclear magnetic resonance (NMR) spectroscopy for dynamic structural information, especially for substrate binding events

For mass spectrometry analysis of MPN_268, a validated approach involves:

  • Protein digestion with sequencing-grade modified trypsin (protein:trypsin ratio ~150:1)

  • Strong cation exchange chromatography (SCX) using:

    • Buffer A: 25% acetonitrile, 1% acetic acid, 1 mM ammonium acetate, pH 3.5

    • Buffer B: 25% acetonitrile, with higher concentrations of acetic acid and ammonium acetate

  • Reversed-phase chromatography on a C18 column (75 μm × 100 μm)

  • Mass spectrometric analysis using collision-induced dissociation (CID) with dynamic exclusion parameters

How does MPN_268 interact with other components of the PTS system?

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) operates through a phosphorylation cascade involving multiple protein components. As a putative IIBC component, MPN_268 likely interacts with:

  • Enzyme I (EI): The first protein in the phosphorylation cascade, receiving a phosphoryl group from phosphoenolpyruvate (PEP)

  • Histidine protein (HPr): Accepts the phosphoryl group from EI

  • Enzyme IIA: Transfers the phosphoryl group from HPr to IIB components like MPN_268

  • Other membrane proteins: May form complexes to create functional transport channels

Protein-protein interaction studies using techniques such as pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation could help identify the specific interaction partners of MPN_268 within the M. pneumoniae proteome . Understanding these interactions is crucial for elucidating the complete phosphorylation cascade and substrate specificity of this transport system.

How can proteogenomic mapping be applied to validate MPN_268 expression and processing?

Proteogenomic mapping represents a powerful approach for validating genomic annotations through direct protein observation. For MPN_268, this methodology can be implemented through:

  • Whole-cell protein extraction from M. pneumoniae cultures:

    • Dialyze extract against buffer containing 2 M urea, 5 mM Tris, pH 8.0

    • Digest with sequencing-grade modified trypsin at 37°C overnight

  • Mass spectrometry analysis:

    • Perform SCX chromatography to separate peptides

    • Subject fractions to reversed-phase chromatography interfaced directly with an ion trap mass spectrometer

    • Collect MS/MS spectra using dynamic exclusion parameters to analyze less abundant ions

  • Data analysis:

    • Map identified peptides back to the M. pneumoniae genome

    • Confirm the boundaries of the MPN_268 open reading frame

    • Identify potential post-translational modifications or processing events

This approach has successfully detected over 81% of genomically predicted ORFs in M. pneumoniae, validating computational predictions with direct experimental evidence . For MPN_268 specifically, proteogenomic mapping could reveal:

  • The precise N-terminal boundary (confirming the true start codon)

  • Potential signal peptide cleavage sites

  • Post-translational modifications that affect function

  • Evidence of alternative splicing or processing events

What are the implications of strain variations in MPN_268 for functional studies?

Strain variations in MPN_268 may have significant implications for functional studies. Research has demonstrated that while M. pneumoniae strains M129 and FH are closely related, proteogenomic analyses can reveal differences in protein expression and structure . When designing experiments with MPN_268:

  • Researchers should explicitly identify which M. pneumoniae strain they are working with

  • Comparative sequence analysis between strains should be performed to identify potential amino acid substitutions

  • Functional studies should account for strain-specific differences in expression levels or activity

  • Complementation studies across strains can help determine the functional consequences of observed variations

The proteogenomic mapping study referenced performed analysis on the less virulent strain FH while referencing genomic coordinates from strain M129, demonstrating the feasibility of cross-strain comparisons . This approach can reveal strain-specific adaptations in the PTS system that might correlate with differences in metabolism or virulence.

How can systems biology approaches integrate MPN_268 into metabolic network models of M. pneumoniae?

Integrating MPN_268 into systems biology models requires a comprehensive understanding of:

  • Its precise role in carbohydrate uptake and metabolism

  • Regulatory mechanisms controlling its expression

  • Interactions with other components of central metabolism

A systems approach could involve:

  • Flux balance analysis (FBA) to predict how alterations in MPN_268 function affect global metabolic outputs

  • Integration of transcriptomic, proteomic, and metabolomic data to build multi-omics models

  • Constraint-based modeling to predict growth phenotypes under various carbon source conditions

  • Identification of synthetic lethal interactions between MPN_268 and other metabolic enzymes

This integrated approach is particularly valuable for M. pneumoniae, which has a minimal genome and relatively simple metabolic networks, making it an excellent model organism for systems biology studies .

How does MPN_268 compare to homologous proteins across bacterial species?

Comparative analysis of MPN_268 with homologous proteins from other bacterial species can provide evolutionary insights and functional predictions. Key aspects to consider include:

  • Sequence conservation patterns, particularly at catalytic and substrate-binding residues

  • Structural comparisons with characterized PTS components from model organisms

  • Differences in genomic context and operon organization

  • Correlation between variations in MPN_268 homologs and differences in substrate utilization

Although Mycoplasma species have undergone genomic reduction during evolution, the retention of PTS components like MPN_268 highlights their essential role in bacterial metabolism, particularly for organisms with limited biosynthetic capabilities that rely heavily on nutrient uptake from their environment .

What is known about the regulation of MPN_268 expression in different growth conditions?

The regulation of MPN_268 expression likely responds to nutrient availability and energy status of the cell. While specific regulatory mechanisms for MPN_268 are not detailed in the provided sources, typical PTS component regulation involves:

  • Carbon catabolite repression (CCR) in the presence of preferred carbon sources

  • Transcriptional regulation by global regulators responding to energy charge

  • Post-translational modifications affecting activity (particularly phosphorylation)

It's worth noting that M. pneumoniae has relatively few predicted transcriptional regulatory proteins, suggesting that regulation may occur predominantly at the post-transcriptional or post-translational level . Experimental approaches to study MPN_268 regulation could include:

  • Transcriptomics analysis under various carbon source conditions

  • Reporter gene assays to identify regulatory elements in the promoter region

  • Phosphoproteomics to detect regulatory phosphorylation events

What are potential applications of MPN_268 in synthetic biology and metabolic engineering?

MPN_268, as a component of the sugar phosphotransferase system, holds several potential applications in synthetic biology and metabolic engineering:

  • Development of biosensors for specific sugars based on the substrate specificity of MPN_268

  • Engineering of substrate specificity to create novel transport systems for non-native sugars

  • Incorporation into minimal cell designs as part of essential nutrient uptake systems

  • Creation of conditional growth systems where sugar transport is coupled to desired metabolic outputs

The well-characterized plasmid construct pOpen-MPN268 with its defined properties (insert size: 354 bp, plasmid size: 2416 bp, high copy number: 500-700) provides a valuable starting point for synthetic biology applications .

How might MPN_268 contribute to understanding M. pneumoniae pathogenesis and host interactions?

As a component of primary metabolism, MPN_268 may influence M. pneumoniae pathogenesis through:

  • Carbon source utilization during host colonization and infection

  • Adaptation to nutrient-limited environments within the host

  • Contribution to biofilm formation or adherence through metabolic regulation

  • Influence on virulence factor expression via metabolic cues

Understanding these connections requires integrated approaches combining:

  • Comparative studies between virulent (M129) and less virulent (FH) strains

  • In vitro infection models to assess the impact of MPN_268 mutations on host cell interactions

  • Metabolic profiling during different stages of infection

  • Systems biology models predicting the metabolic requirements for sustained infection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.